CAZyme Information: MGYG000000141_01653

Basic Information

• Species: UBA7182 sp003480725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7182; UBA7182 sp003480725
• CAZyme ID: MGYG000000141_01653
• CAZy Family: GT2
• CAZyme Description: PGL/p-HBAD biosynthesis glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		30354.99	7.2941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000141	3466199	Isolate	United Kingdom	Europe

• Gene Location: Start: 639605; End: 640399 Strand: -

Full Sequence      

MYYFGLILSIITVCYNAKEDLAQTVDSVLSQTWRNFEYIVVDGDSTDGTKEYLEQLRPSF
KEKNISLRYVSEKDEGIYDAMNKGTLMATGHWVMYLNAGDLFVNASVLRNIFADDPDTQI
LYGDTLCTYQGQVKRYPAKPLSTLPRQMAFCHQSALIERDVALRFPYDTSYKICADHHFF
LKAYSKGLAFEYCGLPIAVYEISGVSDQNKWQAHKEQLRMQKELGELSITPKWILLELVF
FIKLGLKTILGQAFIDKVRKKRLS

Enzyme Prediction     

No EC number prediction in MGYG000000141_01653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	102	1.2e-21	0.5294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06433	GT_2_WfgS_like	3.91e-67	9	209	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
PRK10063	PRK10063	2.24e-35	6	248	1	241	colanic acid biosynthesis glycosyltransferase WcaE.
pfam00535	Glycos_transf_2	1.71e-21	9	139	1	129	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.26e-21	10	129	1	119	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	3.97e-17	8	187	3	187	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO20832.1	4.72e-99	8	263	6	261
ASF42302.1	7.19e-49	7	206	9	204
ALL04398.1	3.71e-46	9	258	10	255
AJI55958.1	1.83e-45	7	239	13	240
ATA84868.1	1.84e-45	8	206	7	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.47e-07	5	112	4	106	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
1H7L_A	3.07e-06	9	122	4	123	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71239	6.97e-31	6	224	1	219	Putative colanic acid biosynthesis glycosyl transferase WcaE OS=Escherichia coli (strain K12) OX=83333 GN=wcaE PE=4 SV=2
P9WMX6	8.60e-21	9	225	7	225	PGL/p-HBAD biosynthesis glycosyltransferase MT3031 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3031 PE=3 SV=1
P0A5A0	8.60e-21	9	225	7	225	PGL/p-HBAD biosynthesis glycosyltransferase Mb2981 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2981 PE=3 SV=1
A1KMV1	8.60e-21	9	225	7	225	PGL/p-HBAD biosynthesis glycosyltransferase BCG_2978 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=BCG_2978 PE=3 SV=2
P9WMX7	8.60e-21	9	225	7	225	PGL/p-HBAD biosynthesis glycosyltransferase Rv2957 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2957 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.602019	0.396464	0.000725	0.000247	0.000222	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000141_01653.