CAZyme Information: MGYG000000141_02910

Basic Information

• Species: UBA7182 sp003480725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7182; UBA7182 sp003480725
• CAZyme ID: MGYG000000141_02910
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000000141_7|CGC2	35385.08	8.5426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000141	3466199	Isolate	United Kingdom	Europe

• Gene Location: Start: 125540; End: 126460 Strand: -

Full Sequence      

MEVDVLIPVYRPDGKLTELLKRLKMQNYPIHRVILMNTEEKHFPTELTGIWDRVEVYHLA
KEEFDHGGTRDRGVRMSTADLVLCMTQDAMPADETLIEELVKPFDDPEVWAAYARQLPNE
DCREVEKYTRSFNYPEQSMVKTKEDLDRLGIKTFFCSNVCAAWRREKYLELGGFVKHTIF
NEDMILAGTMIKQGGKIAYCAKAKVIHSHNYSAFQQFHRNFDLAVSQTMYPEVFGGIRSE
SEGIKLVKKSLSYCIKIGKPWLMIQVVTQSAGKLLGYKMGQRYRSLPMWLILRCTMSPSF
WRGGKA

Enzyme Prediction     

No EC number prediction in MGYG000000141_02910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	169	6.1e-19	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.01e-12	4	168	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	3.20e-12	3	205	56	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	2.83e-09	1	217	3	229	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06423	CESA_like	8.07e-09	5	179	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	7.89e-08	5	227	6	223	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22269.1	2.77e-167	4	301	6	303
QBE96877.1	1.33e-127	3	301	6	304
QMW79879.1	1.33e-127	3	301	6	304
QIB57343.1	1.33e-127	3	301	6	304
QRT31229.1	2.69e-127	3	302	7	306

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	4.23e-64	1	301	1	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000141_02910.