CAZyme Information: MGYG000000143_00097

Basic Information

• Species: Turicibacter sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sanguinis
• CAZyme ID: MGYG000000143_00097
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35655.04	6.2598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000143	2958073	Isolate	United Kingdom	Europe

• Gene Location: Start: 97349; End: 98293 Strand: -

Full Sequence      

MIRVALDGTGDFFTIQEAVDSISDSKPETIYIKKGVYEEKLVIEKPHLTFIGEEAKETII
TFSDYAKKQWNEDEIYQTFRTYTALIGANHLCFSNLTFKNEAGKGSEVGQALALYVDGDC
IQFHDCYFLAHQDTLFTGPLPPAPIKPGSFVGPREHAKREVGRQYFNNCYIQGDIDFIFG
SATAYFEKCTLFSNALNGHSYITAASTQKEEPYGYVFESCQLLSNATPHTVFLGRPWREY
AHVAFLNCYMGHHIHPLGWDDWGKLSSHDTVQFVEYNSYGPGATPHQRASYAKVIDHPTY
YTRERVLKGWNPKC

Enzyme Prediction     

No EC number prediction in MGYG000000143_00097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	296	5.2e-94	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.45e-71	1	283	83	379	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	3.91e-65	1	293	12	270	putative pectinesterase
pfam01095	Pectinesterase	3.11e-63	4	295	4	280	Pectinesterase.
PLN02773	PLN02773	2.43e-59	1	296	6	284	pectinesterase
PLN02665	PLN02665	2.59e-54	2	296	70	341	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS17892.1	6.22e-245	1	314	1	314
AMC07926.1	9.91e-148	1	312	1	314
ACZ98654.1	4.43e-118	3	312	5	321
AGF58031.1	1.04e-112	1	309	1	315
AQR96711.1	1.48e-112	1	309	1	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.90e-32	2	299	9	291	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	4.94e-32	4	309	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	6.97e-30	2	299	11	285	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.35e-29	2	299	11	285	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.11e-28	12	312	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SIJ9	9.81e-47	1	295	50	312	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9LVQ0	7.40e-44	1	295	6	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	8.62e-43	1	295	81	358	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9ZQA3	2.26e-40	1	295	90	365	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q8LPF3	6.85e-40	1	297	60	339	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000143_00097.