CAZyme Information: MGYG000000143_00174

Basic Information

• Species: Turicibacter sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sanguinis
• CAZyme ID: MGYG000000143_00174
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		88331.64	7.4457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000143	2958073	Isolate	United Kingdom	Europe

• Gene Location: Start: 166961; End: 169219 Strand: +

Full Sequence      

METKKIRSHRKWLLFYVLFSTVYFIWRIFFTIPIGYGWFSISCGLILLIVELLGMSEFFI
HFLNVTKLIVPVKPEVVDKELYPHVDVYIATYNEPEELLYKTIIGCKNMAYPDLSKVHIY
ILDDGHRPNVKQLAKHLGVHYISRVDNEHAKAGNLNHALSLTTSPYVVTLDADMIPMKHF
LLESIPFFIENEQKRQLERERGIEEKNLSQKLGFIQLPQVFYNPDIFQYYLFSEDRIPNE
QDYFYRDIQLGKNESNSVIYGGSNTILSREALNEIGGFVTGIITEDIATGMLIQSKGYLS
YAVDSIQASGLSPHDLEGILKQRNRWARGCIQTFRRYCPLLLKGLTWKQRINYTNAIFYW
YNCLKRIIYLSAPIMFTVFNVVVVKANLIQVIVFWLPMYVMIRMTLRRFSGNVRSIKWTN
VYEIIMMPSLIPAVLLESIGLSMKKFEVTRKDKQVVHKNSDILKLAIPHFILLALTFIGM
IRSFYHLFLGDGSEYVIALFWLATNSYGLLMALFFVLGRPVYRMSDRFKIETDVTIEVDH
ELKSLKTYDISEKGIAVQSDFPYLIPSDQVYPISLTREDYQASFKGKLIRVDSDDTYRYV
FEVNEISEENYQELIKILYDRVPHLPSEIVDKSIYNDIERNIRFRRQKNRQFSRTLPRVD
LNLEVVSTQNDHLNIENFNYHYFLVKGKHGFTEVEIPLLTHPQIMLRCQFKQIIERQIEE
QELEFSLFEILNYQDIPLSIWNEEVKMWLTKA

Enzyme Prediction     

No EC number prediction in MGYG000000143_00174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	86	275	2e-23	0.9882352941176471
GT2	210	399	3.1e-17	0.8375634517766497

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	6.79e-101	83	334	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	7.86e-84	13	591	187	752	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	2.12e-44	24	475	1	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	3.02e-22	92	337	7	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06423	CESA_like	1.04e-19	87	286	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS18311.1	0.0	1	752	1	752
QLG36835.1	8.17e-220	17	744	16	731
QKS58548.1	3.60e-218	17	749	16	724
QLY80065.1	2.62e-217	1	736	1	713
AAK79528.1	1.17e-216	1	736	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.77e-64	40	591	229	765	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	5.56e-53	23	538	68	583	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.21e-52	23	538	80	595	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.22e-52	23	538	81	596	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7D5K_A	1.07e-07	277	373	733	836	ChainA, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	2.42e-68	78	589	154	649	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q8Z291	3.68e-65	40	595	229	769	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q93IN2	6.90e-65	40	595	229	769	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8X5L7	4.43e-64	40	591	229	765	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	8.28e-64	40	591	229	765	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34
38	60
367	389
419	441
462	481
496	518