CAZyme Information: MGYG000000143_00533

Basic Information

• Species: Turicibacter sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sanguinis
• CAZyme ID: MGYG000000143_00533
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	MGYG000000143_2|CGC2	83266.93	4.9247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000143	2958073	Isolate	United Kingdom	Europe

• Gene Location: Start: 81626; End: 83854 Strand: -

Full Sequence      

MRDIKQLINQMTLQEKAGMCSGLDFWRLKSVERLGIPKVMVSDGPHGLRKQKDGASDVND
SIKAVCFPAGCATACSFDRDLLYNLGILLGEECQAENVSILLGPAVNIKRSPLCGRNFEY
FSEDPYLSSEMACNYIQGVQSQGVGTSLKHFAANNQESRRMTASAQIDERTLREIYLASF
ENAVKVGKPWAVMCSYNRINEVFASENKKLLTDILRHEWEFDGYVMSDWGAVNNRVEGLK
AGLDLEMPGSHGTNDKLIIEAINKGILDETTLDEAVERIVTKIFEFVDNRQDAIFNRDVH
HEAARKIATQSAVLLKNDGVLPLNKEAKIAFIGAFAKSPRFQGGGSSHINTYKVSSALEA
VSNVTSVSYAQGYELDVDQINEELVQEAIQVAKSSEVAVIFAGLPDFFESEGYDRTHMQL
PNCQNELIKEVVKVQPNTVVVLHNGSPVEMPWIHDVKGVLEMYLAGQAVGLATIDLLFGR
VNPSGKLAETFPLKLSDNPSYLNYQVVDDLIHYREGIFVGYRYYDKKEMNVLFPFGYGLS
YTTFEYHDLVLSRKEMLDTDELVVSLKITNTGAVAGKEVVQLYVSDLTHLTIRPIKELKD
FVKVELQAGETKEVQMTLDKRAFAWYNETISDWYVGTGEYEILIGKSSREIVLKDVIKVQ
STVKLPFKVTANTTFGDLMKHETLRPIIESLAKQIDISNVGQEIDFNLELIQDTPLRELR
TIQNIDNAMIEYLIQTFNHYLS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	248	1.9e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.08e-100	4	651	38	757	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	4.81e-71	312	521	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	1.97e-70	33	356	57	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.40e-67	7	619	56	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	7.05e-42	33	281	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS18858.1	0.0	1	742	1	742
AMC08698.1	0.0	1	741	1	742
ASU30988.1	0.0	2	735	3	750
ANU78179.1	0.0	2	735	3	750
QQQ91519.1	0.0	2	735	3	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.68e-301	3	739	4	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.29e-198	8	702	9	705	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	2.28e-141	3	660	5	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.60e-137	3	660	5	837	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	3.07e-134	1	659	1	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	6.50e-301	3	739	4	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	8.85e-192	8	651	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.41e-190	8	677	9	689	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
B0Y3M6	7.32e-145	3	662	5	832	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
Q4WU49	7.32e-145	3	662	5	832	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000143_00533.