CAZyme Information: MGYG000000143_01914

Basic Information

• Species: Turicibacter sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sanguinis
• CAZyme ID: MGYG000000143_01914
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000000143_11|CGC2	35534.84	5.6237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000143	2958073	Isolate	United Kingdom	Europe

• Gene Location: Start: 66015; End: 66956 Strand: -

Full Sequence      

MRVYEFARKYNMTSKEVVTVCQELGIEVKAQSKLNDESLEVLNGRLSQGKDTEVKEIKEV
VKPTVIKRQKVKKPMLYVVTECEPFTNLGELGKVSKAFVEAQEGDVIVALPKYLNISETF
GNEMDWLMDLPVKFGTHEARASIFKLVEGNVTYLFVGNDHYFHRNEIYGFADDVERFAFF
NRAILDVLPLLGMQVGEIQVNEWHTSMLPLMLHVDYHQHPYFSKVKTTLNIHNLEYQGWY
DASILTEVLGISREYYDNGLTRMGDSVNLLKSGIETAHKVVLTDISAGQMKLDGMVNSGI
TAVLENKVLNQAV

Enzyme Prediction     

No EC number prediction in MGYG000000143_01914.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	76	282	1.1e-44	0.4427966101694915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.51e-49	76	280	2	213	Starch synthase catalytic domain.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.04e-48	74	281	1	213	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.43e-42	76	280	4	201	glycogen synthase GlgA.
COG0297	GlgA	4.75e-32	76	281	4	213	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14098	PRK14098	2.25e-22	76	305	9	250	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS19317.1	7.69e-225	1	313	1	313
AMC09015.1	7.02e-133	1	312	1	312
SMF86241.1	1.25e-43	75	280	3	211
QOT12885.1	2.48e-43	75	312	3	257
ACX64697.1	2.48e-43	75	312	3	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	5.86e-14	70	281	122	359	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNF_A	1.41e-11	77	243	26	212	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6M334	3.90e-38	75	286	3	216	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
Q1WSN1	5.18e-38	75	280	3	212	Glycogen synthase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgA PE=3 SV=1
P39125	5.73e-37	75	280	3	211	Glycogen synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgA PE=2 SV=1
B7GK04	2.11e-36	75	280	3	211	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
A4J4I4	2.78e-36	75	286	3	215	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000143_01914.