CAZyme Information: MGYG000000143_02370

Basic Information

• Species: Turicibacter sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sanguinis
• CAZyme ID: MGYG000000143_02370
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000000143_18|CGC1	43295.76	4.4345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000143	2958073	Isolate	United Kingdom	Europe

• Gene Location: Start: 22383; End: 23492 Strand: +

Full Sequence      

MLKQLETYFKSYINQFKPYKGFWCYEDGVILKGAQDLYIATNDEFYWDYIQAYLNEFVDQ
EGNLKGYNSSEYNIDHVNAGKVLFFAYEKTNDERYKVAIEHQMDQLRTHPRTNSGNFWHK
NRYPHQVWLDGLYMALPFFTEYETVFNGKQQYEDIHKQFMEVYKTHRNKECGLYYHAWDE
SKSMFWCDEETGLSKNYWLRAEGWLLMALIDSIDKMSETIFEYYKGLIDMFVESIDDILP
YQDEKTGLWYQVIDAMDREGNYLEVSGTAMVIYSILKGVRLDILDESYKEKAIKSLKGIL
EVYGYEDEAGYHIGGICEVAGLGSFNGVVRDGSFEYYISEKVVPDEAKGIGPLMMAYAEY
LMVGGNDEL

Enzyme Prediction     

No EC number prediction in MGYG000000143_02370.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	19	361	4.2e-105	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.44e-98	3	361	14	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.64e-79	23	362	27	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS20092.1	1.83e-283	1	369	1	369
AVQ19788.1	4.95e-144	3	368	6	373
ADD02984.1	3.03e-131	5	363	8	371
AEF18067.1	1.58e-128	2	363	1	360
AFK85204.1	3.66e-127	2	363	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.51e-96	23	360	23	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.37e-67	7	359	23	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.78e-67	7	359	13	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.13e-13	23	308	65	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.71e-11	23	301	66	331	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.50e-67	7	359	23	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.61e-38	134	363	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.61e-38	134	363	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000143_02370.