CAZyme Information: MGYG000000144_00605

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_00605
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1115	MGYG000000144_1|CGC15	126234.64	4.5182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 819141; End: 822488 Strand: -

Full Sequence      

MRNIFTLLALLVFGTILCKNHAQTYTIYPTPQKISEAGETVELTQQINVICESGIGEVTR
NRMKEVLEEAGYTIAFSTNPSQTNTNLYIGINGSDGAADRYAVENNLSLAVFETGDNKFD
PYLLQINDLHPHGDIVILGNDKGSEFYAFATLEQILEQTDGNSIRQTTFEDYSHTQYRGI
VEGFYGHPYSVENRISLFEFCKRFKMNVFVYGPKSDPYHLGNWRDDYPTSLTEQQRFFGM
ITQDDLKTMVQAAKACNVDFIWAAHPGLQQGISFSNESAMAPGIDALMKKFDHLYNLGVR
GFGVFIDDMTYTPSGDMQAHLANEVQIKIRERYTTGNTDDQVAPLFFVPTAYALNYGASY
TLNNLKKVDSEVVIAFTGYDCFSNIRPSAIDDMAGRVGRNPVMWWNNPVNDDHDDRIYMR
ELTTHWTIEKPGAINTLNGLILNPMCQAQASKIALFGAADYSWNPNAFDVHKNWEEVFHR
IAEPGDTQTAEAIKCFARFSNTLVEDEEMITLYDNFMEKFGGESFPSESDKLRSELENLK
QACTYIETLKDSPHRDYRLMYEDIRCWNAKLKNISTIALDALDMLEYGNSMSRSEGWEKY
LRLKKLYTGMSSDSTYLVSALEGYGTSTTEKFYEVKPGDSHLRPFTDFLVEKIGNSIPGL
WPAKDSLQIITNIENLQGVELTVQNETIRLTGLNGLDLDKDEYVGIYFGNIEKINVEEIT
ADKTLRVEISENGKQWTPIQLPIREQKTAYIRIKNISEEEVTVDFNQLSVSRILTSVEVK
AEASTNMSQYEYHSITNVVDRNPSTFFWSSEAQAADDYILLTYPSAQPIYEISITFTETD
QLSGTAAIEVSADNDQWQTVTEFTNGHLDSTRSFTCNANGLMARYVRFIIRNTVGSYWLQ
VAEFKADMSEKYTQTTDQSGVQIATLADKDLSTNYQAGEAGYIEHHFIENITIESIEIFH
NTVFDSGSKLPSIYVNNGSEWIEKGSLEPLCTVIDTHEIDTVTAVKIEWNKENIPNLYEI
LPVGTPYVEKPGKPTAINNMKKDGLTIYTNNNRLIVQSDDMIQNIILFDLNGKTINHFNV
NKCIFETTFGSNIPQILIVQVMHTNENLSTCKIIR

Enzyme Prediction     

No EC number prediction in MGYG000000144_00605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	178	497	2.1e-76	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.39e-125	178	496	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	5.60e-13	24	171	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	2.59e-06	780	904	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13697.1	0.0	1	1114	1	1114
BCI64753.1	0.0	10	1113	7	1112
AHF13792.1	0.0	21	1115	5	1245
QUT77745.1	4.87e-307	10	1030	4	1026
QFQ11845.1	1.18e-118	23	1081	22	1100

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	4.04e-77	25	656	34	627	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
2J4G_A	2.33e-64	104	767	51	707	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	2.37e-64	104	767	52	708	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	2.37e-64	104	767	52	708	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2VVN_A	2.48e-64	22	767	21	729	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	1.81e-67	25	988	39	1034	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	1.36e-63	22	767	21	729	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	2.45e-46	19	580	38	549	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	3.24e-46	19	580	38	549	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
O60502	4.46e-21	179	461	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000186	0.999213	0.000148	0.000150	0.000135	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000144_00605.