CAZyme Information: MGYG000000144_00897

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_00897
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	MGYG000000144_2|CGC1	52159.77	4.9722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 68275; End: 69630 Strand: +

Full Sequence      

MPRHVFILFLAWIVPALVEVRADSWSGKSVDFSHGDLCVSPNGRFLQHTDGTPFLYLGDT
AWELIYRLNEPEVELYMENRRAKGFTVIQTVILSELDGSDGINRPLINGSPSTPDPDYFK
WVDRVLEIAGEKGLYVGLLPTWGDKVDKQWGAGPEIFDEANAREYGRWLGRRYADTPNII
WIIGGDRSGEGKNFTVWKAMAEGIKECDKRHLMAYHPQGEHSSSFWFHDETWLDFNMFQS
GHAQRDYAIYRRLLLNDLQKQPIKPVLDGEPRYENIPIDFKSENGRFDDFDVRMTLYQSM
FSGACGYTYGCNEVWQMYSDKYSPMIDAQTTWKESLDLAGACDMIHFRKLCEAIDFFRGR
PLQHLIERPEQTDDDYAVAYGGKDYVLFYMPYGHSITVNLSGWTQRKNVRLEWFNPRNGE
LIFYKNIETSEAFEVVSPTQGRGNDWVLIAR

Enzyme Prediction     

No EC number prediction in MGYG000000144_00897.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	35	448	1e-142	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	2.70e-147	42	350	1	316	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	1.03e-17	361	450	2	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH53452.1	8.31e-199	6	449	9	451
CBK67194.1	4.78e-198	19	449	20	451
QGT72469.1	6.78e-198	6	451	9	453
QUT79277.1	6.78e-198	6	451	9	453
QDM10318.1	6.78e-198	6	451	9	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	7.00e-80	30	449	11	443	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	3.89e-75	30	449	11	443	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	4.60e-71	30	449	24	459	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.999144	0.000162	0.000167	0.000155	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000144_00897.