CAZyme Information: MGYG000000144_01571

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_01571
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		74536.12	6.1311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 884350; End: 886290 Strand: +

Full Sequence      

MKNRLLSYGIISLVLGLTSCHTNDSVKFQFDSKKIVSGKKIAIKDIAPQLPTDWDEYDYV
TIEFRSTTPQRFQLGFTTDSGYNELRLISYVPNAWNKLTIPLRFFRELPVAKHDIAATSN
QPRTTGWINLGGKRGPLTGVDSIGIRMRAPIDNPTIELRSIALSKDDPGDRYLENKPAFD
KFGQWNLGDYEGKIYSEEQLQKEWLQEETEINETENFNYSRYGGYLNKRVKSTGFFRTEQ
IDDRWWLIDPDGYLFLSYGVDCVAPVGDYYTKNTDKCTNMFQELPPRELFVESENVSPET
HTASFGIWNLYRRYGKNYLDRAAEMTIKRMDKWGLNTLANWSDKTIYDKNRKAFILPLEN
IGFENELMGLMDVYDNGIEKKIDEAIVRNVAKYKNNHWLIGYFIGNEPAWISKENRLCSL
ILNGKDRPIKIELQNFLKESGDTPGTRKTFIYNTFEKLMKAISKSLKKNDPNHLNLGIRY
GYIEQLDDELLRISKESFDALSFNCYALSPDHEKMNHALEISGLPMIIGEYHFGTVDRGL
AQSLWQVNSQKERGDAFRYYTENAFAHRGLIGTGWFRWIDQNINGRTDGENYNCGFIDVT
DRPYPYMVDAAIETAKSLYEIHSGTKTPFHQAPNAVGHSPIPDLWE

Enzyme Prediction     

No EC number prediction in MGYG000000144_01571.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	50	619	6.9e-95	0.9770290964777948

CDD Domains     

MGYG000000144_01571 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13634.1	0.0	1	646	1	646
AXP07832.1	2.02e-285	2	645	3	643
BBE17136.1	2.79e-281	11	645	35	665
SCM56829.1	5.12e-281	11	646	11	645
ASB49335.1	8.95e-248	1	645	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XJ9_A	7.34e-61	23	620	56	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
4BQ2_A	1.22e-51	46	626	56	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	3.10e-51	46	626	56	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	6.68e-47	180	619	224	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.39e-44	47	619	286	949	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	1.00e-37	180	637	400	931	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000081	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000144_01571.