CAZyme Information: MGYG000000145_00546

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_00546
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000000145_1|CGC6	36103.72	4.672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 605647; End: 606615 Strand: -

Full Sequence      

MKDKIRFKISACACLTAGIMALSMLAAPVTGYSAQAWDLENGRFVDASGAPIAGALEKGI
TVTKYQNRQSGENGGIDWDKVAKSGVSFAMVRIGYFKDMDPYYSMNMSGAAAKGIKTGVF
FYTQALDSQAAVEEARYVLRMVKDYAVSYPIAYDVESKYLLDNNLSKQQITDNINAFCKT
IAEAGYRPIVYANNEWLTNHIDMSQVPYDVWYARYGTINNYQNRTIWQCTDQGRIDGIDG
NVTIEFSFTDYSSLIPSEGWKVIDGNWYYTKNYVKQTGWVLAGDIWYYLDSNGIMVRDIV
MDIDGYSYTFDSSGAMVQEPAK

Enzyme Prediction     

No EC number prediction in MGYG000000145_00546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	70	238	2e-41	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	7.08e-69	58	248	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	3.53e-29	58	242	1	181	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	6.04e-25	73	238	7	180	Glycosyl hydrolases family 25.
cd06413	GH25_muramidase_1	6.49e-20	58	242	4	184	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	2.03e-19	58	244	64	250	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET59461.1	1.33e-180	8	318	6	316
ADL03867.1	7.32e-178	14	318	12	316
QRV22095.1	7.32e-178	14	318	12	316
ASN93256.1	1.05e-142	11	303	59	349
QRP42084.1	1.05e-142	11	303	59	349

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.73e-11	59	242	69	249	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	7.90e-11	59	242	69	249	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	1.07e-10	59	242	69	249	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002303	0.994723	0.002165	0.000338	0.000231	0.000210

TMHMM  Annotations     

start	end
7	29