CAZyme Information: MGYG000000145_01149

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_01149
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000000145_2|CGC1	63838.72	5.0664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 170306; End: 172027 Strand: +

Full Sequence      

MVNMKANPFYLDEEGVRWVEDTVNSMNLHEKICQLFADPLMGKNREEMAEFLRQYPIAGI
PFRAELFGNEEAQDIMAELQENSRIPYLYAGNCESGPNGVLRGGTLVASGAQVRALRDPG
IAYEVGRITGKETAAVGYNWTFGPVGDVLMNWRNSLINTRAFGSDGDFVSQCVEAYNKGC
MEYGVIPCLKHFPGDGWEERDQHLAVGNNGLSCKEWDETFGKIYQTSIDNGLLSIMVAHF
TLPSYQKKFNPDIEEKDMQPACLSKELVDGLLRRKLGFNGLAVTDQTKMMGFYGMSRMEA
IPWTIACGCDIVLGINNMEEDYGAMKEGIQSGIITEERLEDALYRILACKAAAGLHKKKA
GNGFRPGKEALSCIACEEHIEIARKAAAKAVTLVKNTKGQLPIKPDVYKKIGVFVLSGNV
GHQKSVYGRGVQSGGSEKTVSHVLEALVRYGYEPELMESSMDKGKITDFKARYDAVMLFA
DISGFAQTNSVRLMWPDPMSSCYPWYIHDVPTVFVSFNYTSHLIDVSRVPGFINAYNNRP
ETIDETIRRIAGLAEFEGCYDDDVWCGTWDTRF

Enzyme Prediction     

No EC number prediction in MGYG000000145_01149.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	313	2.3e-45	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.57e-61	26	421	1	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.95e-54	28	347	2	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.99e-15	122	360	99	310	beta-hexosaminidase; Provisional
PLN03080	PLN03080	3.71e-05	260	404	273	416	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCX33673.1	2.57e-180	1	572	3	565
ADQ14511.1	7.20e-178	1	572	1	567
QLC59446.1	1.60e-173	1	572	3	575
QEK07326.1	1.60e-173	1	572	3	575
QSI00383.1	1.60e-173	1	572	3	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	1.14e-105	4	572	6	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	1.09e-41	23	411	39	455	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.92e-41	23	411	13	429	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	5.37e-41	23	411	43	459	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.68e-33	25	407	10	397	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	1.71e-122	1	572	1	563	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	5.95e-41	23	411	39	455	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q7NWB7	2.45e-20	55	320	27	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q5FA94	6.29e-20	122	316	107	290	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1
A9M1Z4	1.14e-19	122	316	107	290	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_01149.