CAZyme Information: MGYG000000145_02356

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_02356
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000000145_5|CGC1	76652.92	5.3928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 16312; End: 18327 Strand: +

Full Sequence      

MLYGVSYYPEHKSKEELEWDLKLIKESGINTVRMGEFTWCRMEPEEGRYDFSWLDPVIEE
LGQAGIRTIVGTPTACPPAWMVEAWPDMLYQDNRRIRRPFGGRRHGCYNHEAYRNACAGI
AKAIGEHYGRNPHVAGFQIDNELAQEGTGRCTCENCRKKFQDWLKLKYGGIEIFNRRSGA
IFWSQEYRSFEQINPPVNAIEPGAQTQIRDFYENPTVRLEFERFSSESQIEFQNIQADIL
KAFTSLPVTTNGTGLVTNSIDYYKGFEQLDCYAFDYYPNLRDAWVDSFPYAFGRGVKSGF
PFWILEFMSGGGHRLSGTGRLQPGPGALKQAVVQAFAHGADLLLHYQFRSFPAGAEQLNY
AIVDLDGIPRRRYDEMKETAAVLKQLEPLKEASFCSEVGILLDYDSHWALKIKPVNEPEF
SYMDFAGKLYYNLERIGIHSDVISLERDFQKYKALVLPASFILKKETAKRLREYVNQGGT
LITTFLTGVKNEDNLGYTIPLPGHLDQVLGVTVQEVEPVFDSNRTRLGIRLASEEDEVET
WDKAWSELLAGEAKLLGSYKETYKKDSMVISQHSYGDGTAYYVGTDLEDPAWRSLFKSLL
GPVCRRKDEIEAPEGVQVISRIWQEKQIYFLFNFSGQEKTVCIPNGKTDFLTKVKLLPEI
ILEQNGFKIIV

Enzyme Prediction     

No EC number prediction in MGYG000000145_02356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	7	384	9e-110	0.9919137466307277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	3.22e-123	7	386	2	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	4.80e-114	1	671	16	671	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	1.35e-43	396	602	1	203	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	7.10e-23	398	518	1	119	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08533	Glyco_hydro_42C	9.93e-05	615	670	1	56	Beta-galactosidase C-terminal domain. This domain is found at the C-terminus of beta-galactosidase enzymes that belong to the glycosyl hydrolase 42 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93225.1	3.47e-309	1	670	5	679
QOV20250.1	1.76e-297	1	669	1	668
QBE96158.1	3.62e-285	1	670	1	668
ANU77233.1	2.95e-284	1	670	1	668
QQQ94819.1	2.95e-284	1	670	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TTS_A	1.29e-99	3	640	11	641	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
6LVW_A	6.32e-93	1	618	1	625	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
4OIF_A	8.14e-87	1	670	15	682	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]
4OJY_A	8.32e-87	1	670	16	683	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
5DFA_A	6.02e-86	1	670	15	682	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D9SM34	3.16e-105	1	613	1	592	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
P94804	2.15e-97	1	651	1	637	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
Q0TUR6	1.31e-93	1	670	14	686	Beta-galactosidase Pbg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbg PE=3 SV=1
B9LW38	3.46e-92	1	618	1	625	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
D5JGG0	3.42e-89	3	641	10	631	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_02356.