CAZyme Information: MGYG000000145_02700

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_02700
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43051.43	5.4047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 109061; End: 110221 Strand: +

Full Sequence      

MAYAKLPGLTWDGTVYENEEMGTCEALLPTGGYPTAHAPAMVELPDGDLLCCWFAGTYEG
SADIHIICSVLPKDSPVWLPIVDISNDPSRSEQNPSLFYGPDHAVWAMYTAQLDRQEGKD
NMQFTAVVRCQKSTDGGRTWGPYETVFPEEGTFCRQPIQILSNGRWIFSNWLCTDSADGL
SGDPSAFRISDDKGKTWRMVMMPKSNGHVHANVIELEPGHLVAFMRNREAYRIHRSESFD
WGESWSEPAPTPLPNNNSSISAVKLQSGRIAIAHNPTCTPTPQPGKAAWPGLRCPVAVAL
SEDGGLTFPIIRWMERGEGFIGDENKTNNKQYEYPYIMQSRDGMLHLAYAARTRQGIKYI
RFEEQDILGHKRESMGVYNPTAAQSH

Enzyme Prediction     

No EC number prediction in MGYG000000145_02700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	30	362	4.3e-33	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.32e-58	30	362	8	335	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.32e-58	47	347	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	4.70e-35	22	362	20	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK76990.1	2.49e-276	1	385	1	385
AXB29891.1	3.39e-274	1	385	1	385
CBL01983.1	5.61e-273	1	385	1	385
CAB1239511.1	4.61e-272	1	385	1	385
QUO31282.1	7.64e-271	1	386	1	386

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_02700.