CAZyme Information: MGYG000000145_02894

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_02894
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		24923.44	4.3494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 33400; End: 34068 Strand: -

Full Sequence      

MAYEVYIDDMLLPLPPEKIPIKYAGQNKTITLINGEEINMIRPPGLAEISLDVVIPQMDY
PCAVWEGSIESAEDFLERLKELKEDGSSFEFIVIRDGPGRNNFFDTNMDVTLEDFKVSDD
VKEGLDLVVSLSLKEYKSYGTKIMNFVIVEEQAVPAASEPEPERKGEPPAIKSYTVKKGD
SLWAIAKKQLGNGSRWQEIYSLNKDKISNPNLIHSGQVLNLP

Enzyme Prediction     

EC	3.2.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	3.15e-17	149	222	82	146	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	5.34e-12	172	221	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	1.56e-11	147	222	189	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
pfam01476	LysM	7.57e-11	174	222	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
NF033163	lipo_LipL71	9.12e-10	168	222	401	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU18165.1	1.98e-114	1	222	1	216
SET48664.1	9.91e-114	1	222	1	222
ANU49161.1	1.14e-113	1	222	1	216
QQR01911.1	1.14e-113	1	222	1	216
QIB68642.1	1.26e-60	1	221	1	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.67e-07	170	222	95	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45932	9.32e-18	3	222	6	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P54335	3.55e-15	2	222	5	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P0ADE6	8.04e-07	170	222	95	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	8.04e-07	170	222	95	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_02894.