CAZyme Information: MGYG000000145_02945

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_02945
• CAZy Family: CBM50
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		30314.58	4.3508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 71053; End: 71856 Strand: -

Full Sequence      

MLEYFGLFLHMFYQFRKKDAVMKIYVVKQGDNVDSIARSQGIPVGTLVFDNQIAPPYRLA
VGQALYIDDGTFAEDRSPLYVFGYAYPFITSENLNNTLPFLTGIYVFSYGFTQEGDLVPP
ESPPEWMVQRALEYGVRPILTLTPLGPDGHFNNNLVTTVVHNMEVQQRLIWNLGLEMAEK
GYGGLDIDFEYIMAEDRLAYVEFVKRTTEVMNQFGYQVSVALAPKTSATQAGLLYEGIDY
GLLGEAANRVLLMAYEWGYTYEPISYR

Enzyme Prediction     

No EC number prediction in MGYG000000145_02945.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	4.72e-44	81	263	4	185	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.12e-32	24	260	51	286	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd00118	LysM	1.98e-08	23	67	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	3.11e-07	24	67	1	44	Lysin motif.
cd00598	GH18_chitinase-like	1.04e-06	101	255	29	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU00666.1	6.17e-139	22	267	1	246
QRV19273.1	2.27e-135	22	263	1	242
ADL06657.1	2.27e-135	22	263	1	242
QJU19362.1	5.50e-116	22	263	1	242
ASN96403.1	4.46e-115	22	263	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	7.75e-22	23	263	5	294	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	1.42e-21	22	263	3	292	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	7.57e-19	87	257	19	185	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	5.84e-06	108	256	37	187	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	3.32e-22	22	263	1	290	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	1.43e-20	21	263	1	291	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O05495	3.43e-20	24	257	49	277	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
Q9K3E4	2.36e-19	21	263	1	291	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O32258	5.46e-06	151	258	101	212	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_02945.