CAZyme Information: MGYG000000145_03733

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_03733
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000000145_10|CGC4	41438.95	5.2087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 219992; End: 221110 Strand: +

Full Sequence      

MISNQLLLEKIHLVVDKLMNLGGCDSDKDKTASSADTSKGFIQRDFGIEEWDWPQGIGLY
GLYKLQEFYSDGRYLPFFNKWYRGHQEHGLPSKNINTTAPFLPLSFLYETLDSPEEYYNL
CVKRAQWLINDLPKTQDRGFQHVTSAIGNRNGVSLNEGQLWIDTLFMAVLFLNKMGQKTD
NESWKDEAAHQFLVHIKYLFDKHTGLFHHGFRFDGMNNFGGIFWCRGNSWFTYGVMEYID
TCGDQLNQGVKDYLIDTFKSQAAALLKLQSSSGLWYTVLTDASSYEEVSGSAAIAAGLLR
GVKSGILDNTFEAAAEKAIEAICANISADGTVLGVSAGTGIGMDPDHYKSIAVMPMAYGQ
ALVLAALCEALK

Enzyme Prediction     

No EC number prediction in MGYG000000145_03733.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	371	6e-91	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.19e-78	50	372	33	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.84e-73	50	372	26	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08132.1	5.93e-220	3	372	2	371
AIQ71725.1	1.44e-180	3	372	2	371
AIQ28570.1	8.32e-180	3	372	2	371
QUL56643.1	1.93e-179	3	372	2	371
AIQ40335.1	9.15e-177	3	372	2	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.76e-70	47	372	61	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.07e-67	47	369	43	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	7.57e-67	47	372	62	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	7.51e-18	49	322	21	298	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	7.28e-40	27	372	7	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_03733.