CAZyme Information: MGYG000000145_03869

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_03869
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788		91251.59	6.4523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 139043; End: 141409 Strand: -

Full Sequence      

MKNEEKKRNRIFLTAMILMTIYLGWRAIFTLPVHDGVLNLIFGILLLGAEIITVFTTFEL
FYQKMKMNKFRLECPVIPEEYYPDVDVFIATHNEPEEILYKTVNACTFMDYPDKTKVHIY
LCDDGNRKEIADLASRFNVGYLGLAENKDAKSGNLNNALSRTSSPLIATFDADMIPQHTF
LMKTVPYFLLSEFIQEDGQWRLRQEEERDENFKMGLIQTPQSFYNPDLFQFNLYAERNIP
NEQDFFSREVNIMRNSSNSVAYTGSNTVIARAAMEEIGGFPLNTITEDFETSIRIQKAGY
ITYATDEIQAAGLTTTTVKGMLKQRVRWAGGVIQSLQNTNAVFTSKLPLLSRITYLNSFL
YWWSFFSRLIFILAPILFALFDIRIVNSNFWDVVVFWLPAYFFYSLSMRYLSGNVRNQRW
SQVIDTIFMPYLIIPVLLETFQIHQKKFKVTNKKKESGGIGWGFMIYAIPHGILLALSAA
AMVRYVNGKYGSALFYSSIIIFWISYNMVALLYAIFFMLGRRAYRSSERIRAEEKIFIEY
ENLKYEAVTMDVSENGVSFWLGMPVYIPDDETIDFRVETSRYEACLKGRIVYVREENGGW
RYSAAVEAAEEKDRRQYFQIIYDRTHSLPMKMDLWITAYDDILRNVKSRLSRPFSDKRKL
SRIRLDKEIVFSNGASCKLVDFNYHYFSVSDFQSNGSTDSKFVYHTVNEIPLVLRRTGVY
VKDSESELLALDNLKDLIRKNQLDQILADIENSDNNEGLKDECLNQYSDDHGGSLLRVGV
HASDKSSA

Enzyme Prediction     

No EC number prediction in MGYG000000145_03869.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	84	331	9.9e-23	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	8.12e-85	83	336	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	8.40e-68	13	445	184	601	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	1.26e-41	38	443	9	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	4.19e-33	92	336	7	232	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13641	Glyco_tranf_2_3	6.74e-21	83	331	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMF90406.1	0.0	5	750	4	751
QIB68972.1	0.0	3	757	13	767
QOS81892.1	0.0	5	753	4	754
QLG37677.1	0.0	5	750	4	751
QKS57765.1	0.0	5	750	4	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	7.18e-61	22	583	213	755	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.82e-53	15	610	61	665	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.04e-53	15	610	73	677	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.08e-53	15	610	74	678	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8Z291	2.48e-62	22	593	213	765	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q93IN2	4.60e-62	22	593	213	765	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
P58931	1.37e-61	5	639	77	686	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q8X5L7	1.36e-60	22	583	213	755	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	3.42e-60	22	583	213	755	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
11	30
40	62
359	381
391	413
426	443
458	480
493	515