CAZyme Information: MGYG000000145_04170

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_04170
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37255.75	6.5958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 176; End: 1174 Strand: +

Full Sequence      

MYAKPIERRLDMTYISQDGKGDFRTITEALASLPEDNSSQKIFYIGKGIYRELVSLTSPY
VTFIGENSENTIISGRLHATMNMGDGSKRGTFRTYTCLVDAHDFTAKNITFENSAGKGTD
AGQALALYADGDRLIFENCRFLGGQDTLFTGPLPPKEVEPGGFTGPKQFAPRINGRHFYK
DCYFEGDIDFIFGSATAYFESCTFFSKYTGREISSYVTAASTPKGQNYGYVMKDCRFESN
CPPENAYLGRPWREYAKTVLIHCYMDSHICQEGWHDWGKLSAHDNAFYGEYGSFGPGAVM
GKRPYWVRRLTTSDLPQYAKEAVLGGTDNWKP

Enzyme Prediction     

No EC number prediction in MGYG000000145_04170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	15	324	5e-93	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.03e-75	15	306	4	274	Pectinesterase.
COG4677	PemB	1.00e-73	22	326	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	1.62e-67	15	318	9	290	pectinesterase
PLN02432	PLN02432	1.80e-60	15	328	15	290	putative pectinesterase
PLN02682	PLN02682	9.82e-58	19	320	78	353	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	2.34e-187	12	332	1	321
QIX89293.1	9.16e-143	8	332	13	348
ANU50094.1	3.71e-142	15	332	19	348
QQR01004.1	3.71e-142	15	332	19	348
QRP39805.1	3.62e-140	15	332	20	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.95e-42	15	327	7	302	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.43e-41	15	306	11	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	2.78e-38	16	332	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.17e-27	15	316	35	355	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	4.93e-24	21	327	17	290	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.22e-55	12	324	6	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	1.75e-48	15	332	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43043	2.55e-47	15	330	61	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q8VYZ3	6.92e-45	12	328	85	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q1JPL7	1.49e-44	15	306	249	519	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_04170.