CAZyme Information: MGYG000000147_00381

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_00381
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218		25344.54	10.7569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 365345; End: 366001 Strand: +

Full Sequence      

MTKSVYEFWLTQGKEKLRLPVLPEQLDVSNNLANESVKVSKFGEVTFINEPGAKTISFSS
HFPKKYSPLAEYKGFLSPENAILKIEKWMKAKKPVQFLVTGTKINFTCSIENFSHREGEK
DIGDRDFDLTLKEYQTASPRKIKQKKKTKKKRPSKPAPKMYTVKKGDTLWYIAGRFYGNS
QEWRKIWNANKQAMIKRSKRNIKQPGHWIFPGQKLKIP

Enzyme Prediction     

No EC number prediction in MGYG000000147_00381.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1652	XkdP	2.21e-37	1	218	51	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
PRK11198	PRK11198	1.02e-15	156	218	93	146	LysM domain/BON superfamily protein; Provisional
smart00257	LysM	1.42e-09	161	217	2	44	Lysin motif.
pfam01476	LysM	1.60e-09	161	218	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	4.52e-09	159	217	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF98194.1	5.71e-159	1	218	1	218
VEB18496.1	5.71e-159	1	218	1	218
AJO17678.1	5.71e-159	1	218	1	218
AGN35851.1	3.31e-158	1	218	1	218
AYQ15912.1	3.31e-158	1	218	1	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	3.28e-06	158	217	28	77	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45932	4.43e-130	1	218	1	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P54335	8.94e-130	1	218	1	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000147_00381.