CAZyme Information: MGYG000000147_01465

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_01465
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706	MGYG000000147_2|CGC15	83347.22	9.2334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 577113; End: 579233 Strand: -

Full Sequence      

MVKEVPIEFKLVNLKIEGWQLLLDFSLDYSVSADNISLLAVNRKTKAELPAFCERIDKEK
AIYRAELRLDALSKHVEDKGCIDFYVRIREAEADLLKKRIQTKFQPIELSWKWDEQKQVF
FLPYTTKKGNLSLKVLPKKTVAEITDIDLNTDGELTLEGYAFLLNEDGKATAKQRCLILK
EVGDAEEKKVFEYPLEDNETANFKVHINLKKLYEENAMPVMFQFHIEFIGEDPETGEKAI
KRTKPLMLKNKANPQNSQFTVIETEKGPARFHVYPQKKKRCMRLRMNDYTFKTRAVYFVV
GKKNRTVSFFRRRKNKLKKKIGNGLKKAYYFTFGLAGKLPVKKKTVIFESFAGKQYSCNP
RAIYEYMTENKPDYEMYWSVNRDYTDIFEEKGIPYIKRFTLKWLFAMARAEYWVVNSRMP
LWIPKPKHTTYLQTWHGTPLKRLAVDMDEVHMPGTNTENYKKNFTMEAAKWDYLISPNAY
STEIFARAFQFNKTMIESGYPRNDFLHTDNNAETVRSLKEKMKLPADKKVIIYAPTWRDD
QFYKKGKYKFDLDLDLAKMRQEIGDDYVIVLRMHYLVAENFDLEPYQGFAYDFSSYEDIR
ELYMVSDLLITDYSSVFFDFANLKRPMIFFVPDIETYRDKLRGFYFDFEKEAPGPLVKTT
DAVLEKIKETEAPGYHLPDVFEPFYQKFCYLEEGRSSEKVVEKIFK

Enzyme Prediction     

No EC number prediction in MGYG000000147_01465.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.37e-155	340	706	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.61e-127	324	706	7	386	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
PRK05841	flgE	0.005	89	217	161	291	flagellar hook protein FlgE; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJI06556.1	5.15e-145	319	706	322	710
AIY76015.1	5.15e-145	319	706	322	710
ARO20908.1	5.15e-145	319	706	322	710
QHS23522.1	2.87e-144	338	704	343	708
AJG93766.1	1.27e-143	320	706	327	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.44e-112	341	706	350	716	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.54e-111	341	706	350	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	4.25e-111	341	706	350	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	1.60e-262	63	706	89	744	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	7.27e-178	314	704	2	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	7.29e-135	314	706	3	389	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	6.43e-112	341	706	350	716	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ2	1.39e-35	315	704	232	603	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000147_01465.