CAZyme Information: MGYG000000147_01539

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_01539
• CAZy Family: PL3
• CAZyme Description: Pectate lyase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222	MGYG000000147_2|CGC18	23763.98	9.67

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 651971; End: 652639 Strand: -

Full Sequence      

MMKRLAGTVILSGLLVCGFGQALPEKASAAEVVHKTIVVEQGQTYDGKGKRLIAGPELGD
GSQREDQKPIFKVENGATLKNVVLGAPAADGVHTYGNASISNVVWEDVGEDALTVKSEGN
VTINGGSARLAADKIFQINKASTFTVKNFTADQGGKFIRQLGGSTFKAVVNIDNCTITNM
KEAIFRTDSSTSSVTMTNTRYSKVGKKWIGVKHITERNNHEF

Enzyme Prediction     

No EC number prediction in MGYG000000147_01539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	31	201	8.1e-76	0.9826589595375722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03211	Pectate_lyase	3.11e-77	20	215	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEB20864.1	1.51e-156	1	222	1	222
BCE04143.1	5.92e-156	2	222	1	221
BCE16530.1	5.92e-156	2	222	1	221
AGN38058.1	6.13e-156	1	222	1	222
AYQ18118.1	6.13e-156	1	222	1	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	8.78e-75	29	212	1	185	CrystalStructure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	3.17e-62	32	194	9	170	Theliganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	3.27e-62	32	194	10	171	Thecrystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	3.42e-61	32	194	18	179	C.bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	3.42e-61	32	194	18	179	C.bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65EF5	8.95e-152	2	222	1	221	Pectate lyase C OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=pelC PE=3 SV=2
O34310	4.74e-108	2	222	1	221	Pectate lyase C OS=Bacillus subtilis (strain 168) OX=224308 GN=pelC PE=1 SV=1
D3JTC1	8.18e-76	2	204	1	202	Pectate lyase A OS=Paenibacillus amylolyticus OX=1451 GN=pelA PE=1 SV=1
Q9X6Z2	6.23e-73	2	204	1	202	Pectate lyase A OS=Paenibacillus barcinonensis OX=198119 GN=pelA PE=1 SV=1
A1DBJ7	8.26e-22	44	184	54	198	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000457	0.941492	0.057147	0.000329	0.000300	0.000235

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000147_01539.