CAZyme Information: MGYG000000147_03753

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_03753
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000000147_10|CGC1	22660.49	6.5678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 6477; End: 7088 Strand: +

Full Sequence      

MDYFKKSTFSTAFILSAGLLLMSIIPQHAFAHGFVEKPGSRAALCSEAYGLLNLNCGSVM
YEPQSLEAKKGFPHDGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAP
HNTSQWHYYITKKGWDPDKPLKRADFERIGTVPHDGSPASRHLSHQIYIPEDRSGYHVIL
AVWDVADTENAFYQVIDVDLVNK

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	32	199	1.6e-54	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	2.18e-82	15	200	10	193	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	9.12e-79	3	203	4	210	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	1.76e-68	32	199	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	3.63e-60	32	198	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
PHA03387	gp37	0.007	118	198	159	248	spherodin-like protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFY40109.1	1.94e-154	1	203	1	203
AJO16673.1	1.94e-154	1	203	1	203
VEB17605.1	1.94e-154	1	203	1	203
BCE13083.1	1.94e-154	1	203	1	203
AYQ15083.1	1.94e-154	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LW4_A	3.66e-126	32	203	1	172	NMRsolution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis],6TWE_A Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis DSM 13 = ATCC 14580]
2YOX_A	4.26e-66	32	200	1	177	Bacillusamyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOX_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOY_A Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens],2YOY_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens]
2YOW_A	4.40e-66	32	200	1	177	Bacillusamyloliquefaciens CBM33 [Bacillus amyloliquefaciens],2YOW_B Bacillus amyloliquefaciens CBM33 [Bacillus amyloliquefaciens],5IJU_A Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens],5IJU_B Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens]
5WSZ_A	3.25e-61	32	203	1	169	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
5L2V_A	3.40e-60	32	202	1	166	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	1.12e-50	15	199	14	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q838S1	1.62e-46	5	200	2	193	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q7MEW9	1.76e-45	20	198	12	198	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1
Q87FT0	9.74e-45	20	198	12	199	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
Q8D7V4	1.32e-44	20	198	12	198	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.999079	0.000163	0.000162	0.000136	0.000131

TMHMM  Annotations     

start	end
9	31