CAZyme Information: MGYG000000148_00130

Basic Information

• Species: Faecalimonas phoceensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas phoceensis
• CAZyme ID: MGYG000000148_00130
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1118	MGYG000000148_1|CGC3	126676.81	6.1522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000148	2855435	Isolate	United Kingdom	Europe

• Gene Location: Start: 147598; End: 150954 Strand: -

Full Sequence      

MKSIRKRFVAIILLAVMVFSDFQMSTSLAMDNSSAVEETEVAETDAANTVKAENRLNYIL
VESPYLESPNTQNIVVSWGDGTEQISNMRITVQKEDGSTEEWTCSNQSGYLYVFSKEYVD
ESEQSTYKVTDIRFEENQQEQCFLLTDLNVEAEFGVNKAYDGIEELQPLDPEDAVETSIV
TIDENGETEAQDNIASALTAVSEEMGAVAGIRSAEKAGEIVVALDPGHDNRHGGTSGSGL
TEQELTLKIAKYAKAELETYNGVKVYMTRTTAACPYPKTGTSGACIEKRVQAAAEAGAKI
YVSLHLNSGAASANGAEIIIPNSSWKPQLSTQGKELAEKILNELTAVGLNKRPTPIYSKD
TTVNEKYPDGSISDYYSVQICAKEAGIPGIIVEHAFLSNANDVNKFLKTEAGLKKLGVAD
ATGIAKYLGLSKGQWVQVGDKWKYLTNGKYVVNQWMNISGETYYFDGNGYRVTGWQTIAG
KKYYFMSDGHMHTGWLSFGSRYYYMMPDGHMHTGWLSFGSTYYYLNSEGIRVTGWQTIDG
QRYYFMPDGTRYSNGWLSFGSTYYYMMPDGHMHTGWLSFGSTYYYLNSEGIRVMGWQTIE
GKEYYFDQNGVRKDNIKKSGWQTINGKKYYFDKNGEYVTGWQTIAGKKYYFMSDGHMHTG
WLSFGSRYYYMMPDGYMHTGWLSFGSTYYYMNDEGLRVTGWQTIAGKKYYFMPDGTRYSN
GWLSFGSTYYYMMPDGHMHTGWLSFGSTYYYLNSEGIRVTGWQTIAGKEYYFDQNGVRKD
NIKRSGWQTINGKKYYFDKNGEYVTGWQTIAGKKYYFMSDGHMHTGWLSFGSRYYYMMPD
GYMHTGWLSFGSTYYYMNDEGLRVTGWQTIAGKKYYFMPDGTRYSNGWLSFGSTYYYMMP
DGHMHTGWLSFGSTYYYLNSNGVRVTGWQTIDGEEYYFDKNGVRQEGYLIEGTSAVTANS
LAMYFKRKNGVYPIFYKNSDAPTIEKFCQIYVEEAKAEGIKVEVAFMQAMVETGWLKFGG
AVQVSQYNFAGIGALDGGAQGATFKTVREGVRAQIQHLKAYANEKPLNNTQVDPRFHLVK
RGSAKYVEWLGQKENPNGYGWATAEDYGYKILRLIKEL

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	988	1117	3.5e-22	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	2.76e-40	721	942	444	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	6.77e-40	555	804	444	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.50e-39	618	861	442	640	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
cd02696	MurNAc-LAA	3.76e-37	221	425	1	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
NF033930	pneumo_PspA	3.67e-36	784	966	442	628	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50579.1	4.10e-103	71	440	119	506
QRO35993.1	8.67e-74	56	441	107	487
QBF76227.1	8.67e-74	56	441	107	487
CBL13779.1	7.94e-73	56	433	165	541
CBL07763.1	2.52e-72	56	433	164	540

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.62e-24	980	1118	64	195	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1
Q06320	2.21e-07	220	432	2	179	Sporulation-specific N-acetylmuramoyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlC PE=1 SV=1
P54525	2.86e-07	222	427	32	203	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000784	0.996630	0.001926	0.000235	0.000190	0.000170

TMHMM  Annotations     

start	end
7	24