CAZyme Information: MGYG000000148_01797

Basic Information

• Species: Faecalimonas phoceensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas phoceensis
• CAZyme ID: MGYG000000148_01797
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MGYG000000148_14|CGC1	28761.62	4.5262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000148	2855435	Isolate	United Kingdom	Europe

• Gene Location: Start: 11625; End: 12371 Strand: -

Full Sequence      

MDSDGLIQAGEGLWQVTWMDVRVGEILPTPRHGKPVEINAYWYNALCIMEQFASLVNRTW
EYSQLKEQVKVSFVEKFWMEDRRCLKDLVSGTKADRQIRCNQIWAVSMPFTMLDETKERQ
VVETVFETLYTPYGLRTLEIADEEFHSNYQGEMEERDMAYHQGTVWTFPLGAYYLAYLKV
NGYSKEAKADVKDQLEVIESAMREGCIGQLPEIYDGENPTRSKGCFAQAWSVGEILRVYA
VIEKREGE

Enzyme Prediction     

No EC number prediction in MGYG000000148_01797.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	2	237	1.6e-76	0.6505376344086021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	4.29e-96	1	237	130	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	4.57e-51	1	239	385	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01561	gde_arch	1.50e-44	1	178	394	575	glycogen debranching enzyme, archaeal type, putative. The seed for this model is composed of two uncharacterized archaeal proteins from Methanosarcina acetivorans and Sulfolobus solfataricus. Trusted cutoff is set so that essentially only archaeal members hit the model. The notable exceptions to archaeal membership are the Gram positive Clostridium perfringens which scores much better than some other archaea and the Cyanobacterium Nostoc sp. which scores just above the trusted cutoff. Noise cutoff is set to exclude the characterized eukaryotic glycogen debranching enzyme in S. cerevisiae. These cutoffs leave the prokaryotes Porphyromonas gingivalis and Deinococcus radiodurans below trusted but above noise. Multiple alignments including these last two species exhibit sequence divergence which may suggest a subtly different function for these prokaryotic proteins. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
TIGR01531	glyc_debranch	6.72e-17	3	238	1183	1460	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEI31026.1	1.03e-130	1	246	401	646
QHB23534.1	1.03e-130	1	246	401	646
QRT29816.1	1.03e-130	1	246	401	646
ABX42704.1	4.92e-112	1	246	402	648
QCJ02488.1	6.17e-109	1	247	402	658

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000148_01797.