CAZyme Information: MGYG000000149_00993

Basic Information

• Species: Clostridium saudiense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium saudiense
• CAZyme ID: MGYG000000149_00993
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000000149_7|CGC1	28758.13	4.578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000149	3780856	Isolate	United Kingdom	Europe

• Gene Location: Start: 95424; End: 96194 Strand: +

Full Sequence      

MKSNIKYRGLNSYVLSDKKTMLYKFAMIIILSSLMIVTIFSTIKIKISQSVTNVRYISEE
TGNDNINDSIEEENSADVNSDISNEKVVEVNLNVNLDDDKIEFLNKISHGAIKSYEEYGI
LPSITIAQAILESGWGQSDLAVTHNNLFGIKADSRWSGAIATVSTSENYNDTTIANFRKY
DNIEDSIEDHGRFLYENSRYAESGLFSGKNYKEQAQALENAGYSTVRNADGVAVYADKLI
ALIEKYNLMEYDNKVK

Enzyme Prediction     

No EC number prediction in MGYG000000149_00993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	111	248	3.1e-37	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.28e-50	96	253	39	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	3.48e-38	103	252	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	2.82e-34	102	245	154	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	2.45e-27	111	248	4	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.81e-23	102	252	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEK39773.1	6.03e-65	93	248	58	213
CEJ75314.1	1.21e-64	93	248	58	213
AUN13203.1	1.21e-64	93	248	58	213
QYE98430.1	3.44e-64	93	248	58	213
QEZ68765.1	1.90e-63	93	248	58	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.34e-18	103	252	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.02e-17	99	249	2	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.43e-17	99	249	2	151	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.47e-14	111	243	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.57e-14	111	243	13	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.40e-27	98	252	46	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.61e-19	98	249	158	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	9.32e-17	98	248	159	311	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P15931	2.78e-16	96	249	148	300	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9I4P4	8.03e-15	102	225	241	370	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999909	0.000092	0.000000	0.000000	0.000000	0.000010

TMHMM  Annotations     

start	end
21	43