CAZyme Information: MGYG000000149_01532

Basic Information

• Species: Clostridium saudiense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium saudiense
• CAZyme ID: MGYG000000149_01532
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		24397.35	10.4862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000149	3780856	Isolate	United Kingdom	Europe

• Gene Location: Start: 48239; End: 48868 Strand: -

Full Sequence      

MSIKRMQGLFQGTLVAQGAFSIYKTELVKSLDGWSDAIGEDIVLTWQMLMKNNRVYFEPL
AVSFTDVPTKFSHFYKQRSRWARGMIEGLRLVKPWQQPNMFLKFLTGIDLLIPYMDLSYT
IFFIPGCVLALFGKFYIVGPIMLLVLPITLLTFIIFYFKQKTFFKALNLKVRKNKLGFTT
FILFYQMIMSPISLIGYLQELFGAKRVWK

Enzyme Prediction     

No EC number prediction in MGYG000000149_01532.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.96e-16	1	208	199	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	7.19e-12	3	155	196	359	N-glycosyltransferase; Provisional
PRK14583	hmsR	6.47e-10	3	194	217	411	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd04190	Chitin_synth_C	1.13e-08	10	86	143	242	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
pfam13632	Glyco_trans_2_3	6.09e-08	18	132	74	191	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDM70252.1	2.65e-113	1	208	88	295
AUN14224.1	2.30e-106	2	209	247	456
CEJ73509.1	3.25e-106	2	209	247	456
CEK38003.1	9.24e-106	2	209	247	456
QYE99472.1	3.72e-105	2	209	247	456

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HCN1	1.90e-10	3	119	188	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6G608	1.90e-10	3	119	188	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q6GDD8	1.90e-10	3	119	188	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.90e-10	3	119	188	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q8NUI7	1.90e-10	3	119	188	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
110	132
136	158
177	199