CAZyme Information: MGYG000000150_00976

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_00976
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	MGYG000000150_3|CGC4	66418.22	4.7113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 213173; End: 214912 Strand: +

Full Sequence      

MRVFANHIGFDKTDDKTAVLELEKEAAELTAWLEADDGERYDVSVSGPERIPDWSEGCYY
VLDFSDVRREGTYRIAGNADGKAFRSEIIPITGYFLNLRMVNASRAYLKGERSSGEWLKA
DRNVPFKGVGEGTLDLHGGWYDATGDFGIHLTQLSHTAVFNPMQSLLPSYVCFDLVGRME
REELQDCRILKKELLDEAYWGADYAMRLHREGGGFIRSVDRGEAFSEEQHRTIDYEYFRF
SGHEEDRSYLAETIEEKHYETCMRSGSGLAVAVLAQASRYRGASGEYSCGRYLAAAEEAF
QYMTEHNEQYSSDGTWNFLDWYCALAAAEELYEATKSQDYLEACRRFFGELERSAIAMED
GIWFLSRQGELYFHPSDEGFPLITIMKYGSLEPDEMRRTRAMELVAQAFVHVLSISRKPF
GYAAFTQKTGEEERNRYFFPHDTKAAPWWQGENARIASLAAAALRFSCQKEAAEMAGDLR
KFAGHQLDWIMGCNPFDSCMIDGFGRNNIQYFFRNQYDFMNSPGGICNGITSREADDKGL
EFMMAPTEECDDNWRWAEQWLPHACWYLNAMGWKLKRVK

Enzyme Prediction     

No EC number prediction in MGYG000000150_00976.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	104	515	1.2e-35	0.84688995215311

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	5.00e-14	125	397	37	281	Glycosyl hydrolase family 9.
pfam02927	CelD_N	8.18e-08	2	75	2	76	Cellulase N-terminal ig-like domain.
cd02850	E_set_Cellulase_N	1.21e-07	6	85	5	85	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34812.1	3.84e-154	1	570	1	580
AZS16657.1	1.68e-131	1	571	1	583
ABF39431.1	2.43e-120	1	571	24	605
AUD01838.1	4.77e-117	1	571	26	609
AYB34129.1	3.23e-114	2	568	29	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3H7L_A	7.07e-98	3	571	4	561	ChainA, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_B Chain B, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_C Chain C, ENDOGLUCANASE [Vibrio parahaemolyticus]
5DGQ_A	1.69e-90	1	576	1	573	Crystalstructure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGQ_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGR_A Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum],5DGR_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum]
6GDT_A	3.94e-86	1	571	1	559	Crystalstructure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_B Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_C Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_D Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_E Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_00976.