CAZyme Information: MGYG000000150_01406

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_01406
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		67941.38	4.7069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 56776; End: 58545 Strand: -

Full Sequence      

MERILNYGEYEVFSEAAASCTASVMEKGEGRAVTEFCFRSDCVSEKGSAVEIRYSFPILD
ICGRWHPNCRADRALKADWELPAASMTAVSAPVVCFFNSESRNRHTIAASELCQEVDINA
GVHEEDGRMAVKIQFVLSAQKMSEGYSFRLWESQENIPYWDTLNQVRQWWEDGMPPVMEV
PEEAREPVYSFWYSWHQDINASVVEEEAARAAEMGFDTIIVDDGWQTGDNNRGYAFCGDW
APEPGKFPDFPEHIRRVHAMGIKYMLWFSVPFVGKNTGCWDRFSDKLLCYDERQRAGVLD
LRYQEVREYLLAVYIKAVREWDLDGLKLDFIDEFYMREETPVWRAGMDYRDIQEALDVFM
TAVRETLRREKESLLIEFRQRYIGPNMRRYGNMFRVADCPCSPVTNRVGCVDLRLLCGDS
AVHSDMLMWNRGERPEEAAMQVLSCLFGVPQISVRLADIDDGMAEMLRFWLNFMRQHRTL
LQMTVIRAKEPENLYPEVSVENETEEILVHYSAGRVIRPAKGKKICSCVNALHAQEQILI
LDPVRPVTITVKDCRGNTVESMELNGTDNRIQDLIRLSMPACGLCELRW

Enzyme Prediction     

No EC number prediction in MGYG000000150_01406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	167	513	4.8e-33	0.5130813953488372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	9.78e-66	184	476	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	3.97e-13	185	348	1	169	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.35e-10	192	377	48	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	8.83e-07	192	566	299	642	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14790	GH_D	1.50e-04	185	287	1	92	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU17504.1	1.61e-211	26	586	27	583
QQQ94451.1	2.53e-177	26	444	27	446
ANU76873.2	6.04e-177	26	444	52	471
ASU29676.1	6.04e-177	26	444	52	471
QUO31288.1	1.70e-174	44	583	43	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNR_A	9.47e-09	182	329	326	478	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2YFN_A	2.84e-08	185	349	329	493	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16551	5.61e-09	177	358	283	470	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
Q9ALJ4	5.18e-08	182	329	326	478	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	1.71e-07	185	349	329	493	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_01406.