CAZyme Information: MGYG000000150_01886

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_01886
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000000150_7|CGC3	96774.42	4.6397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 41526; End: 44030 Strand: +

Full Sequence      

MEHRITLNGTWNWCDTETKEWHKGSVPGTVLTDMADGGLIEDPYWRTNEYETRELSRRDY
RYEREFEVPDSFFRETEQCLVFEGLDTIADIYLNDELLLAVRDMHRTWRIDVKGKLKTVN
RLAVTFHSPIAFIEKADREGDIFYASTGCMKGNGALRKAHYMFGWDWGPQLPDAGIFRSV
YLSGYSGARLEDVRVRQEHGDTGVKLSLESSVRMPGRSEMSEAYTLACEITAPDGTGIFV
SQTVHPGSTACTSETIEALIEDPQLWWPNGYGEQPLYTVRAELKAAGAVLDVWERTIGLR
TVTVCTDADEWGNQFAFVVNGQKIFAMGANYIPEDNLLGHLSEERSERLIRDCARANFNC
IRIWGGGYYPEDYVYDACDRYGILVWQDLMFACNVYDLNDEFEADILAETADNVKRIRHH
ACLALWCGNNEMEWGWRDWGRLEGHRPKYKADYTKIFEMLLPRLVKQVDDQTYYWLSSPS
SGGSFDDPNDFNRGDNHYWEVWHSNKPFTEYRDFYFRFCSEFGFQSFPGKKTLDAFSLPE
DQNIFSEVMESHQKNGLANTKIFSYISGYYKYPKDMESIAYISQILQLKAIQYGVEHWRR
NWGRCMGSIYWQLNDCWPVASWASVDYYGRWKALHYGARRFYSRFMATACEKEELSTDIG
YYIHNESFEERKAVLVVRLFDRDFHTLYETETEAVTGPFEVKQVLAMDFAPFLTEEGMKK
KAVAEYRLIEDGCVVSRGTTLFVKPKYFEFQKPEYRISVTEREDVFCIHVDADTYVSYAE
LSMDEYDVIFEDNFFDITSEEGVDITVDKKEFPNRITAEEAAAALHIRSVADSF

Enzyme Prediction     

No EC number prediction in MGYG000000150_01886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	687	1.1e-109	0.6662234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.66e-97	1	642	9	629	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.47e-12	174	435	195	453	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	3.49e-12	752	832	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.90e-12	188	300	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	2.25e-08	662	747	6	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18719.1	0.0	1	834	1	826
QQO08489.1	0.0	1	834	1	828
SET87559.1	0.0	1	834	1	836
QRV20341.1	0.0	1	834	1	845
ADL05496.1	0.0	1	834	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.64e-143	5	758	9	765	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.78e-143	5	758	11	767	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.86e-143	5	758	11	767	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.52e-143	5	758	9	765	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
6BYE_A	1.65e-141	21	831	32	851	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QYN2	2.27e-97	26	640	32	651	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1D911	8.71e-96	4	640	6	651	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q5B7W2	3.12e-95	25	640	31	651	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	1.69e-94	26	640	32	651	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	6.29e-94	26	640	32	651	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_01886.