CAZyme Information: MGYG000000150_03188

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_03188
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000000150_13|CGC2	57769.79	5.0427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 104498; End: 106051 Strand: -

Full Sequence      

MELKVICMTARSATLETEAGQIFEFDTQGEVYVNGSLYQRTNRVIFSLFGLKPDTEYEVC
LKRDGAEARTVFRTDYEFVTINVKEFGAKGDGLQDDTGFIQAAILACPKNGRVLIPKGTY
RITSLFLKSHIRLELGAGAVLAADTDRFKYPRLPGMIESYDETEDYNLGTWEGNPLPMFA
GIINGIEVENVVIYGEGLIDGQASFENWWKDAGTMRGAFRPRMVFLERCKDITLQGFYLK
NSPAWVLHPYFSQGLRFLDLDIENPADSPNTDGLDPESCKDVEITGLHFSLGDDCIAVKS
GKIYMGRRYKTPSENIEIRQCLMENGHGAVTVGSEVGAGVKAVRVRDCLFRHTDRGLRVK
TRRGRGKDSVLSDISFQHIVMDHVMTPFVVNSFYFCDPDGKTEYVQCREALPADERTPEI
QNLSFTDIKAANCHAAASFLCGLPEQKIRKIELRNVDILFAEQAREGVPAMMEGVSACSR
QGFTVMNVDTLVCENVTITGQKGDAFIMSNIEHFKEV

Enzyme Prediction     

No EC number prediction in MGYG000000150_03188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	109	478	1.8e-71	0.916923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.33e-94	82	503	84	535	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	2.02e-31	183	442	48	289	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	2.87e-31	65	458	22	374	polygalacturonase/glycoside hydrolase family protein
PLN02218	PLN02218	4.26e-29	69	441	59	392	polygalacturonase ADPG
PLN02793	PLN02793	4.26e-28	83	459	55	395	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET55359.1	1.97e-291	1	515	1	515
VCV21973.1	4.93e-238	1	514	1	516
CBL09361.1	4.93e-238	1	514	1	516
CBL11994.1	7.00e-238	1	514	1	516
AEN96748.1	5.25e-228	1	512	1	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.16e-44	81	366	28	335	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.51e-33	83	366	47	344	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	1.73e-24	97	489	26	373	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	7.09e-23	46	432	115	536	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MR0_A	1.14e-07	71	156	106	195	Crystalstructure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6],4MR0_B Crystal structure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	1.39e-48	222	445	23	247	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	8.87e-42	85	477	67	445	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q8RY29	7.07e-27	80	442	67	393	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
P43212	2.27e-25	54	458	32	400	Polygalacturonase OS=Cryptomeria japonica OX=3369 PE=1 SV=1
P15922	2.69e-25	50	432	114	529	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_03188.