CAZyme Information: MGYG000000151_01498

Basic Information

• Species: Clostridium paraputrificum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium paraputrificum
• CAZyme ID: MGYG000000151_01498
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000000151_3|CGC5	36489.63	10.0621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000151	3486414	Isolate	United Kingdom	Europe

• Gene Location: Start: 351697; End: 352635 Strand: +

Full Sequence      

MVKRRRKVYKRRKINRNKYKFLIRRVFAFILLVTFFMGLKYIFSSKKEFISSESINNYIE
YVDSFSGWRKQLNWKEVAAIDGIKNIDFNNINKKKIEEICKWFYDENNNIKDFEKVIEGQ
SFTDKERKKAEKNLKKLSEVSLRNIRGDSDKEKDKLIENMKKISIDNYKKSGVLPSVTIS
QAILESNWGKSELSAKYNNYFGIKASVGWNGKIATFSTKENYNDTIKANFRAYDSLEESV
NDFGNFLNVNGRYRKHGLFDGKNYIEQAQALEDAGYSTKKNSKGEAIYADLLIELIKDNN
LMIIDNEAVKNE

Enzyme Prediction     

No EC number prediction in MGYG000000151_01498.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	162	301	3e-33	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.82e-43	152	306	42	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	5.68e-27	169	297	168	295	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.19e-24	169	301	176	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	1.16e-23	161	243	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	2.14e-20	155	291	10	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED93088.1	2.30e-67	50	308	55	322
QJA07870.1	3.96e-67	1	310	1	320
ARC87071.1	2.88e-63	26	308	23	314
CDI48504.1	5.12e-63	26	312	12	302
QZY57494.1	7.58e-63	54	312	29	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.16e-14	172	301	20	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.40e-14	172	301	21	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	9.50e-14	172	301	21	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.69e-13	164	305	41	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	9.85e-13	169	302	19	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.45e-17	168	301	63	194	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P58231	1.47e-12	169	278	165	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	1.47e-12	169	278	165	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
Q9X9J3	2.90e-11	169	295	176	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	4.14e-11	169	302	168	300	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000024	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
21	43