CAZyme Information: MGYG000000151_01647

Basic Information

• Species: Clostridium paraputrificum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium paraputrificum
• CAZyme ID: MGYG000000151_01647
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000000151_3|CGC8	49562.75	4.9351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000151	3486414	Isolate	United Kingdom	Europe

• Gene Location: Start: 510368; End: 511645 Strand: +

Full Sequence      

MAVKVSDNQRTFIKDGKKFFYLADTCWSAFTNITIEEWEYYLNLRKMQGFNVLQINIMPQ
WDASGTDLNYYPLPTKDKKTFEFTDFNMEYFERAKTMCKMAKDKGFELALVVLWCNYVPG
TWASNMNSSNIMPYDFIDKYVEVVHGTFSDLEPMYVISGDTDFDTEDTKKYYMKASNLLR
ELAPNLLQTLHIKGRLDEIPEEFIDKIDFYMYQSGHNAQNLAMPYLLAETLYKKYPAKPL
LNSEPCYEQMGFSRRMYGRFYRYDVRRAAWMSILSGASAGVTYGAHGIYSWHKINKNFGL
GIGEGFDAPNPWNDAVKYPGAWDYGYIKYIFEMYNIGELVPMDKILNEVKDIRMAGTLEK
DKIFIYVPVNTTVKVDLDLSDYNIKIMDLEDKNICIPNYEVVDGKTTIHMHNFEQDGLII
LEKEI

Enzyme Prediction     

No EC number prediction in MGYG000000151_01647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	3	378	2.3e-111	0.8907766990291263

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	2.03e-105	8	334	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJH02030.1	3.27e-246	3	423	4	426
AQR97273.1	3.22e-245	5	424	6	431
AGF58583.1	2.64e-244	5	424	6	431
QNM10846.1	3.76e-193	3	422	2	423
QQR00078.1	1.26e-177	3	425	2	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.66e-20	14	376	30	394	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	9.62e-18	14	366	30	384	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000151_01647.