CAZyme Information: MGYG000000152_01329

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_01329
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723		82018.9	5.1904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 51339; End: 53510 Strand: -

Full Sequence      

MKYESSKASHNNYFPWEESAFHVYGERDREVITLMANRFIGQNPQAPYQYRLDFTSGITC
DTKGWYQFDFGSLFFHGAVGEVCYGAGSLYSHSQTISQFQIQCWGPTVCWVNGEKVFHSA
PSQEGLKSCCTFSIPLETGLNHFLLETEKTEIGFGFFLRNSQPQWQPSHFTAPLAERKGQ
AGFVCSAPVARELVDVPALVNGSFEGLSWFPKQQYEEPVSSCSLSRIFGRDSQGTAAAKS
SFFHRKSGNVVIKGSSNQPLKVYINGNLSLEWSEGAFEKEMTLPGGRYEVILLCEKKAGE
ETGLAIEFQDESGNLPLCAGVKGYEGEWIYTGLFEEEVPPVSHFAAMDKVYPGSKGTCYW
KADLPDSFVRIFAEQELYGKWTYPCGVTLYGLLKAGEYLDRPDWLQYVQEYARMTADVYD
YSIYDKSVFGYPGVNTQLCWLTELDDCGSFGSFLLEANRQNPTAQARALADVIADFMKHR
QRREKDMVFSRNDNTMWIDDMYMSIPFLCRYSRLSGKEEYLTEACRQALLFKQYFFMPEQ
NLMSHIVDLEYKKMNKIPWSRGNGWVLMALSELLLVLPTDHPDHKAIAEFFTEMAKGILP
VQDENGLWHQILDDPSTYEEASSTSMFICALSRGIRLGILDGELCRESISAIYLAWEGMK
KRVINRRGDLYGVCQGSGCSFSRSYYRQLGWRFNDPHGIGIAVLAGAEKLMLDEFLLHSQ
ISQ

Enzyme Prediction     

No EC number prediction in MGYG000000152_01329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	377	708	4e-81	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.87e-60	380	712	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.00e-49	376	712	29	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET97662.1	2.85e-185	430	723	3	296
QZN74147.1	7.92e-152	13	721	6	726
APO43433.1	1.77e-151	13	722	4	740
QZN78692.1	4.96e-151	13	722	4	740
QLG37373.1	5.41e-151	13	722	4	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.59e-41	314	712	10	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	1.90e-21	364	708	20	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
4WU0_A	7.14e-21	381	708	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
2GH4_A	7.33e-21	364	708	10	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.23e-18	492	710	162	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.04e-20	364	708	20	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	3.33e-19	381	710	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	7.31e-17	490	659	151	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.14e-16	497	714	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P0A3U6	5.60e-14	503	712	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_01329.