CAZyme Information: MGYG000000152_01465

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_01465
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000000152_5|CGC7	44155.52	4.8974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 215751; End: 216917 Strand: -

Full Sequence      

MKQADSSLTPANIYVCADQERFQDSYRRWQGIPSIEVTEKGRIFVNFYSGQAAEVGGNIM
MLCVSDDHGNTFRSCETVVEHPDPECRIYDPNLWIAPDGRLWMFYTQARGFNDGRSGVWL
TICDHPDGTPLVWSDPVRIANGIMMNKPIITSKNEWLFPCAIWCDTSGSIPSERHGLENE
QFSNVYASTDQGKTISLRGHADIPNRSFDENMIVEKKDGTLWMLVRTFDGIGESFSTDGG
YTWTPGQKCHIDGPCSRFHIRRLKSGRLLMINHYHFDQRIDLDDIMSQGNVKSWKGRSHL
TAMLSEDDGQTWPYTLLLDERNEVSYPDAVEAADGYIYVTYDWERVTQREILMARFTEED
VLRGRLESQGAELRVLVNKALGGVDVHG

Enzyme Prediction     

No EC number prediction in MGYG000000152_01465.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	31	346	7.4e-27	0.9005847953216374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.51e-41	24	357	12	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.41e-27	41	339	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	1.16e-04	91	356	90	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam04616	Glyco_hydro_43	0.004	71	247	45	220	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08978	GH_F	0.006	33	113	61	138	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18850.1	3.41e-215	1	386	1	386
AWL41261.1	1.98e-164	7	381	6	376
AEN08048.1	4.13e-164	7	381	6	377
QDU15387.1	2.06e-108	1	382	27	390
QDT79764.1	2.92e-108	3	382	29	390

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_01465.