CAZyme Information: MGYG000000152_01861

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_01861
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000000152_7|CGC2	43133.49	4.7542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 89220; End: 90335 Strand: -

Full Sequence      

MNREKAAMAFQNAMEITEKHQNEFLKGFPAPASENNWYPVIENIDWTAGFYTGLIWMFYE
RGKNRSFREAAEKHVKSFRRRIEERVVVDHHDMGFIYTPSCVAAWKLIQDSFARETALLA
ADNLKDRFQEKGSFIQAWGQLNDAGEYRMIIDCLMNLPLLYWASEETKDMSYQEIALKHL
ETARRVLVRGDDSTYHTYYFNPETGEPVYGATKQGYSDDSTWSRGQAWGVYGLALNYSHC
RKPEIVMQWKGVTDYFLSHLPEDLAAYWDFYFMSGDEPRDSSASAIAVCGILEAYKQGMC
EKSYKDKAEEILESLIDHYAARPEEDGNGLLKHSTYGRLLGEGIDEYCLWGDYFYVEALM
RVMDPCWEPYW

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	42	361	2.2e-123	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.31e-32	45	362	28	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.32e-05	88	342	79	326	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19155.1	1.53e-177	1	371	1	371
ABX43386.1	7.06e-140	4	371	16	391
ASM68396.1	5.79e-139	1	371	1	381
SET79949.1	3.07e-136	4	371	16	391
QBE96661.1	5.01e-135	4	371	16	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	6.58e-118	9	371	31	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	6.80e-118	9	371	32	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	3.88e-117	9	371	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	3.88e-117	9	371	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	5.49e-117	9	371	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9A0T3	7.89e-122	1	371	25	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	1.64e-120	1	371	22	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	3.72e-117	9	371	32	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	1.47e-95	9	362	5	364	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	3.57e-46	21	361	42	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999966	0.000051	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_01861.