CAZyme Information: MGYG000000152_02143

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_02143
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000000152_8|CGC3	97441.34	5.1422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 154623; End: 157139 Strand: -

Full Sequence      

MGKTQSLNGVWKWHPQGASHDTAYTGEVPGTLISDMFRHKLIEDPYWRCNEYGVRELMGK
DYLYERSFTVPGEDLEFSCAELVCAGLDTIASIRINGRLVAETRDMHRTYRFPVKEYLQE
GENRIEILFRSPLEFVRKEDEGNDIFYASTGCIRGNAALRKAHYMFGWDWGPQLPDMGIF
RDIAIEYFSTPKIGDVHIRQNHENREQVGLKFEVTIKQPPSYMESLENGRTWFTETEITD
PEGVAVSKKVRTVGEGQFEEIIPGPELWWPNGLGEHPLYKVRVRLLDEAGTYHDTYECRI
GLRTVTVSTDKNEYGNEFAITVNGIKIFAMGANYIPEDNILTRVTKERTAQLIRDCAAAN
FNCLRVWGGGYYPGDYFYDKCDEEGILVWQDLMFGCNVYRLNDSFEEDIVEETKDNVRRL
RNHACLALWCGNNEMEWGWADEWARLKGHHPRYKADYTKIFEYILPRAIRACDDTTFYWP
SSPSSGGAFDDPNGIHRGDQHYWEVWHSGKPFTEYGDFSFCSEYGFQSFPHSKTIASFTL
PEDRNIFSRVMESHQKNPAANGKILNYTADYFLYPKDTDSLAYISQILQLKAIEYGVEHW
RRKRGQCMGSLYWQLNDCWPVASWASIDYYGRWKALHYGARRFYAPFTISIGEEKELSPH
VYYYVHNDTREEERGRTEVLLKDHQFRVLWEESWEGSIPALSVVKSMEADFSAWADDEML
RSSVFSVFRLYRKEELVTERTVLFVKPKHFDYKAPVYDVSVSESEHSFDITVKASCFCQY
VELYFKDFDVIFSDNFFDITSPEGITVHVKKESFQCHMTPDQVKENLVVRSVADSYGS

Enzyme Prediction     

No EC number prediction in MGYG000000152_02143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	692	3.2e-106	0.663563829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.65e-101	1	646	9	631	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.19e-15	755	834	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.89e-11	664	749	6	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.60e-09	193	303	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	3.33e-06	178	434	169	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET87559.1	0.0	1	838	1	838
QRV20341.1	0.0	1	838	1	847
ADL05496.1	0.0	1	838	1	847
QQO08489.1	0.0	1	836	1	828
QOV18719.1	0.0	1	836	1	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	3.13e-143	6	833	7	851	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	3.22e-143	6	833	7	851	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.27e-142	6	817	18	841	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
6BYI_A	2.28e-142	6	833	5	849	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.34e-142	6	833	7	851	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	6.13e-102	7	654	9	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	9.20e-100	1	654	1	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q95327	1.34e-99	6	657	24	701	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
A1CGA8	2.48e-99	28	654	32	663	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B0YBU9	3.45e-99	1	654	1	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_02143.