CAZyme Information: MGYG000000152_02842

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_02842
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000000152_12|CGC1	72191.25	4.7767

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 77854; End: 79746 Strand: -

Full Sequence      

MMDCLKKRYDRLKITEIQPEGWFYRQLEIQMNGLSGKLYEIWDSVGSYSGWLGGTGENWE
RGPYYLDGLLPLAYYLKNEEKMALCQRFIDWTLNSQTEDGNFGPFASREDYWSRFVMLKV
LVQYEEISGDTRVFSFMKKYFTYLDKAVDIRPMEDWSSARVGELLYCLKWYCEATGETGL
TGFAHKMEKQALDWSDLFENFPFTRPVSYYYNWQQLLLEARDRTDKIIKYHATHIVNVTM
GLKYPALEYYFGGKSSLCDLGKKAMETLRKYHGVVSGAVNGDEHLSGNSPIQGSELCSVV
EYMFSLQVLLEIFGDMEYADMLERLAYNALPSTMTEDCMGHQYLQQVNQVLVSKAERNWF
NNDDTSNMYGLEPHFGCCTANMHQGWPKLADSLWMKEEKDTLISLVLAPSVVAASLDGEE
VSVRLDTEYPFKDTLTYEVLKAPQKPMKLKIRVPGWCSEPRAELIRGEAVTVEINSSFIE
VSGLLSPMDRIDVVFPMDIVYSSWYKDSVAIERGPLVYGLNMKEHFTVYKECAGVKDYMI
SSESPWNYALKKGGRVQVSEHEVSAVPFSKSNPPVTLTGTGIRVDNWILENDSAGDIPVS
PVPKHGNEEILELIPFGCTRLRVSQFPYYE

Enzyme Prediction     

No EC number prediction in MGYG000000152_02842.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	294	518	3.5e-29	0.42366412213740456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.03e-30	64	518	62	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.25e-19	73	528	76	511	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	1.34e-120	9	627	40	649
ALL07583.1	4.80e-116	9	627	40	649
QJE95537.1	9.45e-116	9	627	40	646
AOM80627.1	3.64e-113	9	627	34	643
QNK64903.1	8.90e-111	9	627	34	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.15e-13	209	520	226	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.95e-11	209	520	226	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	9.06e-11	295	518	315	544	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	1.63e-07	294	520	380	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_02842.