CAZyme Information: MGYG000000152_03358

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_03358
• CAZy Family: PL34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000000152_15|CGC2	76439.3	5.707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 95318; End: 97294 Strand: +

Full Sequence      

MSNLVFIGDLGPYKEQIKGVRKKQYQRLLEQADRYEAYELPAQHPKESTTYMGVAIMNLA
LAYCLSEEDKYLFQAKRFIEAVLSYEKWGNAHLVNVDLSASWILFGLSLGYDWLKPFLGE
EEKEQIRAKIKHHADIMYQYKLDTYGHGWSTNYYQNHNWINMTGLAAAGYVLSGTYDDAI
QYIEEAKKNFSRVFSLLANDGSNYEGVPYWRYGGMWLFVYAHLLKVQEGMDYFQTSNYLK
HTFYYRLYQSCGDFEQQMNFGDSHDRHSGHAPCVYYKAAAEYGDGFAQTYANLVLDEFLM
AEAEKSKIKPGILPEAAFEFLWYDPEVTGKPLSLLPKVRFFEDLGLLSIREDWSRDSKVL
TIKCGCPGGRKQWMNGWDLYRREGVKCLSLSHHHSDNLSYIFARGSKYLTCEDGYNRNLM
PDNHNVILVDNQYTDAVNVNDVYMSSARKRMEKDSSYPIEEKYRGEVVYVEFDNSMVIYK
GETSGIYPEELAMKEVSRLLFTDHLSFFLFVDVCVSERDHIYRIISNTDMPAQKQNDHTY
YYPMETGGITYTVLSDQGICSDQYTQEIVSVMTTQEPDKLCRSFINTLSFQSASPTKKQT
FMECFTFDGMNTEITFKDDKLHVRHGEKDYRLIFGDEMSVRIIEVSSKNGERKSYRIP

Enzyme Prediction     

No EC number prediction in MGYG000000152_03358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL34	336	541	8.2e-16	0.9458128078817734

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	3.96e-11	56	323	215	470	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV19037.1	0.0	1	658	1	658
QUI24674.1	1.13e-174	1	588	1	575
ADO83901.1	1.62e-158	9	629	11	612
QEN05098.1	6.08e-132	5	658	6	636
QHJ13006.1	1.12e-125	1	602	1	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JP4_A	1.37e-07	111	490	147	495	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_B Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_C Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_D Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]
6JPH_A	1.37e-07	111	490	148	496	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]
6JPN_A	1.81e-07	111	490	148	496	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_03358.