CAZyme Information: MGYG000000152_03412

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_03412
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000000152_15|CGC3	56259.91	5.1896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 157330; End: 158781 Strand: +

Full Sequence      

MKGFPEDFLWGGATSSAQLEGGFDQGGRGKSQLDYVTFIPKEQREERLSTSEVDYDRYVD
AIKNEDHYNFPYRRGIDFYHHYKEDIKLFAEMGFKVFRMSISWCRLFPTGLEETPNPEGI
QFYHNVFDELHKYNIEPLVTMIHYELPIALTEKYNGWESPEVIGLFTKYTKVLLDEYKDK
VKHWIVFNEINMMLASPFTGGGLFLKKAKKNRLSTIHQALHHQFIASALTVKYAHETAKD
CMVGCMIARLECYPYTCKPADIEAAMIEDQINFYFYDVMARGTYPKSILRYFKENDIEID
YVKDYQDILKNNTVDFLAFSYYMTYVVSADEDKRENPGDLVKKLKNPYLKSSEWGWGIDP
IGLRVTLNRIYDKYQLPIFVVENGLGAVDQLENNAVHDPYRIDYLREHIKAIKKALEDGV
EVMGYTPWGCIDLCSASFADMTKRYGFIYVDQDDEGNGTLGRIKKDSFYWYQKVITSNGE
DLE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	479	1.1e-140	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	482	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	483	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	483	1	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	483	3	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	7.21e-161	4	482	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTZ57784.1	3.95e-224	4	482	3	479
AGS46819.1	3.95e-224	4	482	3	479
BBK63065.1	1.21e-223	4	482	3	481
QNM13367.1	9.55e-223	4	483	3	482
VTS96688.1	1.51e-221	4	482	3	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.84e-186	2	482	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	4.67e-172	1	482	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	2.20e-158	1	482	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.25e-158	1	482	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	2.08e-153	5	482	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.16e-183	2	482	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.41e-173	4	483	7	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	5.00e-173	1	483	1	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	2.00e-157	1	483	1	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P42973	4.34e-155	1	482	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_03412.