CAZyme Information: MGYG000000152_04254

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_04254
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000000152_22|CGC2	41739.2	4.9567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 75708; End: 76832 Strand: -

Full Sequence      

MMTNEQLLKKIHLVVEKLMNLGGYDYDQDKTVSSNDTKKGLIQRDFGIEEWDWPQGVGLY
GLYKLQEFYGDGRYLPFFEKWYSGHQKKGLPSKNINTTAPFLPLSFLYGSLDNQEEFYNI
CAQRADWLINDLPKTPDNGFQHVTSAIGDRDGVSLNNGQIWVDTLFMSVLFLNNMGYISK
NSLWKDEALHQFLVHIKYLFDKQTGLFHHGFSFERMDNFGGIFWCRGNSWFIYGVMEYLD
TCGDGLSQGVRAFLTDTFKSQASALLRLQSASGLWHTVLTDDSSYDEVSGSAAIAAGLLR
GVKSGILDSSCKAAADRAIEAICANISEDGTVLNVSAGTGIGMDGDHYKNIALMPMAYGQ
ALTLTALCEALQKE

Enzyme Prediction     

No EC number prediction in MGYG000000152_04254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	371	5.2e-87	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.03e-82	19	371	6	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	7.69e-74	50	371	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08132.1	4.61e-252	2	374	1	373
AIQ28570.1	3.87e-188	2	372	1	371
AIQ40335.1	1.29e-186	2	372	1	371
AIQ71725.1	2.59e-186	2	372	1	371
QUL56643.1	6.99e-185	2	370	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.21e-65	47	372	61	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.37e-64	47	373	62	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	2.99e-64	3	369	4	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.29e-15	49	322	21	298	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.06e-11	42	342	24	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	9.43e-43	26	372	6	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.67e-10	42	342	24	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_04254.