CAZyme Information: MGYG000000152_05106

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_05106
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		23904.48	10.1707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 46497; End: 47138 Strand: +

Full Sequence      

MKNRKIELSADNRKEVIVLPINPTTVEFTEAQLNQKITLLNIGEANLKGNRGLTGTSLSS
FFPSKKSPFYKHAKKKPKEYVELLKKWKTNNTVVRVIVTDMGVNMAMLIDNLTFSMNEGD
EDIYYKIDLSEYRTLNVPSVKIDTKVKSNGLTERPNTAGAGNTHTVVRGDTLWAIAKKYY
GNGSQYTKIYNANTDKIKNPNLIYPGQVLTIPG

Enzyme Prediction     

No EC number prediction in MGYG000000152_05106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	164	212	5.4e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	6.35e-23	164	212	98	146	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	2.97e-19	126	212	176	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	1.72e-12	163	211	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
NF033163	lipo_LipL71	3.04e-11	167	212	413	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
pfam01476	LysM	1.19e-10	164	212	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP40970.1	8.26e-67	2	212	3	219
ASN94349.1	8.26e-67	2	212	3	219
AVM69700.1	1.45e-45	19	212	15	214
AJA42537.1	4.94e-43	3	212	2	224
AJA42672.1	9.60e-43	5	212	3	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.26e-11	142	212	83	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]
6VE2_O	2.27e-06	159	211	26	77	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	1.36e-25	14	212	14	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	2.19e-23	14	212	14	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P0ADE6	5.90e-11	142	212	83	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	5.90e-11	142	212	83	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2
Q9RVY3	9.62e-06	164	213	206	253	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000029	0.000004	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_05106.