CAZyme Information: MGYG000000153_00708

Basic Information

• Species: CAG-45 sp000438375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-45; CAG-45 sp000438375
• CAZyme ID: MGYG000000153_00708
• CAZy Family: GH31
• CAZyme Description: Oligosaccharide 4-alpha-D-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000000153_3|CGC1	87869.2	4.9078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000153	2962513	Isolate	United Kingdom	Europe

• Gene Location: Start: 18934; End: 21231 Strand: +

Full Sequence      

MFGKITDYTLEGQKLVIRFEEREGVIEAVTDEIINVFSGFETKEHRSKAIEGEKRKKVKA
LVSRDDAGIVFTTAKLEVHIADGFKVDIYDADGNLLCADYRGKREYTKQVSEEFLKLIRA
EGHDVVDGDGLDYKIQIVKKMQGDEKFYGLGDKPGFLDKRHYDYEMWNSDLPQAHTDAFK
ALYKSVPFFITLRDTCVYGLFFDNTFKSFFNMAKESENYCFFGANAGNLDYYFIGGDTMR
GVIENYTYLTGRTPLPQLWTLGYHQSRWGYETKEEILDIAKKYREYGIPCDTIHFDIDYM
DGYRVFTWDEKNFGKPGDVIGQIAEMGFKTVTIIDPGVKLDPGYAKYDEGIAGDYFAKTP
EGEVYVNAVWPGDAVYPDFGKPAVRAWWADNQKYLVDLGVRGVWNDMNEPASFNGELPQD
VVFTDEDREITHAEMHNIYGHLMSKATYEGLKKWDQKRPFVITRACYAGSQKYTTFWTGD
NQSLWAHLQMAIPQLCNMGLSGLSFVGTDVGGFGADTTGELLARWVQVGCFSPLFRNHCA
KGNINQEPWLFGDEVREIYKKYVELRYRLLPYLYDLFREEEQTGMPVMRPLVLHYEKDPE
TFTKNDEFLFGERILVAPVTEQGAHKKMVYLPEGEWYDYDTREKISGGKYFLKEAPLSVC
PIYVKAGTVLPNYESMHYIGEKELDTLVLDVYPGDGSYVNYQDNGEDFAYRDGAYNLYRF
TQSGGKLTIELIHDGYEKKYRQFVIRSGGREQTVSFTGEALKVKL

Enzyme Prediction     

EC	3.2.1.84

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	231	670	8.6e-172	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	127	763	135	772	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	0.0	232	670	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06604	GH31_glucosidase_II_MalA	0.0	251	584	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
cd06603	GH31_GANC_GANAB_alpha	2.64e-177	251	674	1	430	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PLN02763	PLN02763	5.23e-132	136	720	64	648	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08673.1	0.0	1	738	1	740
VCV23578.1	0.0	1	738	1	740
CBL13912.1	0.0	100	738	4	644
BCN32798.1	0.0	1	765	1	766
CCC57802.1	0.0	1	743	1	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JR6_A	1.02e-136	3	762	31	792	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	1.55e-135	3	762	31	792	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
5DJW_A	6.27e-121	148	731	65	644	Crystalstructure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F0E_A	1.98e-118	64	728	101	786	Murineendoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
5IEF_A	1.53e-115	130	728	213	841	Murineendoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	2.66e-199	31	732	54	738	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
B9F676	7.59e-120	164	728	255	839	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
P79403	1.94e-118	130	728	245	873	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
Q4R4N7	5.30e-118	130	728	245	873	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
Q14697	1.45e-117	130	728	245	873	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000153_00708.