CAZyme Information: MGYG000000153_02412

Basic Information

• Species: CAG-45 sp000438375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-45; CAG-45 sp000438375
• CAZyme ID: MGYG000000153_02412
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	MGYG000000153_13|CGC1	72852.32	6.1158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000153	2962513	Isolate	United Kingdom	Europe

• Gene Location: Start: 26382; End: 28286 Strand: +

Full Sequence      

MTGKFSELDMYYFGQGTHYEIYKQMGAHPAEEDGVQGVLFQVWAPHAAQVYVIGTFNGWN
ENANEMERLKPEEAGIYACFIPGVKCGELYKYLIVTSDGTKLYKADPYANYAEKRPGTAS
AVADIMHFKWSDDAWMKARAAVKDIYAQPMTIYEVHPGSWMRHPGREDEGFYTYRDLAHS
LTAYVKEMGYTHVELMGIAEYPYDGSWGYQVTGYFAPTSRYGTPEDFMYLINYLHKNKIG
VILDWVPAHFPRDAHGLADFDGEPLYEYADPRKGEHPEWGTKIFDYGKAQVKNFLIGSAL
LWIEHYHVDGLRVDAVASMLYLDYGKQPGQWVPNQFGENKNLEAVEFFRHINTLITGRNH
GTVMIAEESTAWPMVTGPAENGGLNFSYKWNMGWMHDFLDYMKLDPYFRKGNHNKMTFAM
SYNSSERYILVLSHDEVVHLKCSMLNKMPGLEDEKFKNLMVGYAFMLGHQGKKLLFMGQD
FGQSREWSEERELDWYLLEDPRHKHLQDFVKALLHLYKKNPCMYENDHDWGGFEWLNAND
ADRSIFSFVRKSKDGKNNLLFVCNFTPVAREDYRVGVPKASTYKLVLNSDDAAFGGSGEK
RPASIKAEHSECDGREYSIAYPLPGYGVAVFSYK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	184	483	2e-147	0.9933554817275747
CBM48	24	111	5.9e-16	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	6	634	101	724	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	25	633	27	621	glycogen branching enzyme; Provisional
PRK12313	PRK12313	0.0	1	634	3	628	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	7	631	605	1220	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	7	633	8	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV23983.1	0.0	5	633	4	632
CBL13518.1	0.0	5	633	4	632
CBL10287.1	0.0	5	633	4	632
AEN98279.1	0.0	5	633	4	633
BAK46815.1	0.0	6	633	5	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	2.20e-216	9	630	133	770	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	2.20e-216	9	630	133	770	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.12e-216	9	630	133	770	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	4.41e-216	9	630	133	770	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	6.24e-216	9	630	133	770	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30539	1.49e-305	6	634	8	633	1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
B8CVY1	1.16e-234	6	624	7	618	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q1AZ86	2.54e-231	6	624	100	710	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q7NL20	5.97e-230	6	631	104	726	1,4-alpha-glucan branching enzyme GlgB OS=Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) OX=251221 GN=glgB PE=3 SV=1
Q8DLB8	2.91e-228	4	630	105	747	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000153_02412.