CAZyme Information: MGYG000000154_00113

Basic Information

• Species: RUG115 sp900066395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG115; RUG115 sp900066395
• CAZyme ID: MGYG000000154_00113
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000000154_1|CGC2	55162.31	4.7771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000154	2998358	Isolate	China	Asia

• Gene Location: Start: 125656; End: 127092 Strand: +

Full Sequence      

MKTFRKDFLWGGATAANQFEGAWDVDGKGASVSDMCTNGSHTEPKKVTRTIHPEYLYPSH
EAIDFYHHYKEDIALFAEMGFKVFRLSIAWTRIFPTGMENEPNEAGLAFYDKVFDECLKY
GIEPLVTISHYEMPYALIEKYNGWEARECIDYFLNYCKAIFERYQGKVKYWLTFNEINGG
TTPLGNLLSLGTVKGYEGKITEIPDDPKVRFQALHHQFVASAKAVKLAHEKYPEYLIGDM
NVFMTKYPFTCNPEDVLATQKEMRIMNWFCSDVQVRGEYPAYMERYFEENNIHVKMEPGD
EEILREGCVDFYTLSYYMSSCVSKDPNGEQTDGNLIAGLKNPYLKASDWGWQIDPQGLHY
SLNEIYDRYQIPVMVVENGLGAYDKLEEDGSIQDDYRIDYLRDHIKEMKEAVKDGVDLMG
YTPWGCIDLVSASTGEMAKRYGFIYVEKYDDGTGTLARRKKKSFDWYKEVIASNGENL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	475	4.4e-150	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	478	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	478	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	478	5	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	476	1	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	478	3	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44001.1	9.30e-298	1	478	1	478
QFJ54814.1	1.20e-293	1	478	1	478
BCN32466.1	1.22e-286	1	478	1	478
QRT31043.1	1.56e-280	1	478	1	478
QJA03662.1	1.73e-277	2	478	3	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	4.24e-199	3	478	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	1.00e-192	2	478	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	7.04e-181	1	478	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.01e-180	1	478	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.33e-173	6	478	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	2.32e-198	3	478	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	2.56e-190	2	478	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.12e-186	1	478	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	9.21e-182	3	478	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.57e-175	1	478	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000154_00113.