CAZyme Information: MGYG000000154_02266

Basic Information

• Species: RUG115 sp900066395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG115; RUG115 sp900066395
• CAZyme ID: MGYG000000154_02266
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000000154_2|CGC11	39362.44	4.4196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000154	2998358	Isolate	China	Asia

• Gene Location: Start: 392834; End: 393862 Strand: -

Full Sequence      

MITISLCMIVKNEEQVLSRCLDSLAGLMDEIIIVDTGSCDRTREIATRYTDKIYDYIWKD
DFADARNFAFSKASMEYIYTADADEVLDDENREQFRLLKEAMVPEVEIVQMKYVTKNEFN
TVLNFKEEYRPKLYRRLRTFTWIDPIHETVRLDPVVFDSDIAITHLPQSLHSSRDFKGFL
LAFDRDGRLSEKLHRMYAKELLMTGEKEDFIAAAKVFLATLQDETASGDARKEAGCILSR
CYRITGNVNEFFKLALKDMITTPCAEICCELGNYFFDAEDYDEAAVWYYNAAFETASILD
VHTSGNIPLNGLADCYEKSGNAAQAEEYRNAARQWQLPDDNS

Enzyme Prediction     

No EC number prediction in MGYG000000154_02266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	141	2.5e-17	0.8529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.93e-44	3	185	1	178	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	2.14e-17	5	147	1	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	3.60e-15	1	256	2	266	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
TIGR04195	S_glycosyl_SunS	6.96e-13	3	96	58	153	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
cd06423	CESA_like	7.86e-12	11	123	6	126	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97869.1	8.05e-157	1	340	1	355
CBL07590.1	4.03e-145	1	341	1	356
VCV20559.1	4.03e-145	1	341	1	356
CBL14430.1	4.88e-142	8	341	1	349
CBK93274.1	1.15e-136	1	339	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSK_A	1.63e-09	12	99	76	165	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
7MSP_A	9.57e-08	3	92	55	146	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	1.19e-07	3	92	55	146	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42460	6.50e-15	1	87	7	93	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
P44029	4.96e-12	3	85	3	85	Uncharacterized glycosyltransferase HI_0653 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0653 PE=3 SV=1
O31986	6.54e-07	3	92	55	146	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	6.54e-07	3	92	55	146	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
Q54435	3.63e-06	3	93	6	95	Lipopolysaccharide core biosynthesis glycosyltransferase KdtX OS=Serratia marcescens OX=615 GN=kdtX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000154_02266.