CAZyme Information: MGYG000000154_02475

Basic Information

• Species: RUG115 sp900066395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG115; RUG115 sp900066395
• CAZyme ID: MGYG000000154_02475
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000000154_2|CGC18	62876.38	5.6776

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000154	2998358	Isolate	China	Asia

• Gene Location: Start: 639021; End: 640664 Strand: +

Full Sequence      

MKLSLYNLRKGFRYLKNYGLKEFFIRLKEKGEPEQISYAEYAAGHKVTEAQLKIQTKESD
KWSYRPLISCVYMGENREDVLAMLEQQSYTNWNVTCINKLCTGKEIELSGEYAALIEAGD
TLEPDAFYELAHAIAFPKETKQSGIHWEEIGKPDLIYTDEDVRCSDESKTTETAEPLLKP
DFSPDYLENYCYIRHLCCIRKTVFLQTLEESDGNPAIEELICRAAKQSDSIIHIPKVLYH
TKAEHAPRVEHASMAAGSHERKQPLVSILIPNKDEKASLEKCITSIRQGSYRNYEIIIIE
NNSKSEEIFDYYKELQMQYPDIRVVEWKPEIPGTFNYSAINNYGASYAKGEYLLFLNNDI
EIITKDYMERMLTLCGKENTGAVGAKLYYPDDTIQHAGIVIGIGGHARGIAANMCVGQVR
NDSGYMYRASLRQNLSAATAAFLMVPAKVFREVDGFCEALSVAFNDVDLCLKIRKKGYLI
IYEPSVEAYHYESKSRGQEDTEEKVRRFQEEIEYMRTRWIDILKQGDPYYHPGLTRYRTD
YSLGQKH

Enzyme Prediction     

No EC number prediction in MGYG000000154_02475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	267	402	3.7e-17	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.70e-35	268	492	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.98e-28	262	547	1	264	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	5.46e-26	109	240	83	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	2.30e-18	267	403	1	131	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	1.80e-17	265	491	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ92271.1	3.97e-142	2	543	14	604
QJU15221.1	5.07e-142	2	543	22	612
ASU27528.1	5.07e-142	2	543	22	612
ANU74723.1	5.07e-142	2	543	22	612
QIB58022.1	8.93e-141	2	543	14	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.15e-06	265	371	6	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.19e-62	66	543	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.26e-47	110	543	402	840	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000154_02475.