CAZyme Information: MGYG000000155_00546

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_00546
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		29421.78	3.9579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 106960; End: 107823 Strand: -

Full Sequence      

MQNANSHKKMYKSGKNWVAAMVATVAVAMVPMTMTTSASADDSAQPTSSWRAKTVEDVQT
AVQAAGDTYVVQAGDTLSTIASATALTTDEIAAANGISDVHFILVGQEIKLTADAVVASE
APVEEAAAEETAPVAEVAPVEEAVVEQAPVVEEAAVETPAVEAPVAEAPVVNAPSAPSYN
TNGNSYYAGQCTWYVKNTLSWVGNYWGNANQWADSAAAAGLLVDSNPTVGSVAVFMPGVA
GASVWGHVAVVTGVNGGMVTISEMNAQGEYVISSRTVSAAGVLFIHQ

Enzyme Prediction     

No EC number prediction in MGYG000000155_00546.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	3.15e-24	166	282	46	164	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK08581	PRK08581	2.44e-22	177	280	497	608	amidase domain-containing protein.
pfam05257	CHAP	3.73e-22	182	265	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
cd00118	LysM	3.74e-11	68	111	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.91e-10	68	111	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIE79035.1	4.22e-145	1	287	1	288
QBZ02930.1	6.23e-129	1	286	1	291
QYU58682.1	1.63e-126	1	286	1	280
QBZ04977.1	1.66e-119	1	286	1	281
QBZ04070.1	5.48e-94	1	286	1	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2LRJ_A	3.88e-17	178	280	3	103	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
4CGK_A	4.57e-17	177	274	278	371	Crystalstructure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39],4CGK_B Crystal structure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39]
2K3A_A	5.61e-16	181	279	47	143	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
5T1Q_A	1.24e-06	189	280	251	348	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLV2	5.06e-14	175	280	136	248	Staphylococcal secretory antigen SsaA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=ssaA1 PE=3 SV=1
Q7CCJ3	5.06e-14	175	280	136	248	Staphylococcal secretory antigen SsaA OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=ssaA PE=3 SV=1
Q9KJT6	5.06e-14	175	280	136	248	Staphylococcal secretory antigen SsaA OS=Staphylococcus epidermidis OX=1282 GN=ssaA PE=3 SV=1
Q5HDQ9	7.86e-14	179	286	159	267	Staphylococcal secretory antigen ssaA2 OS=Staphylococcus aureus (strain COL) OX=93062 GN=ssaA2 PE=3 SV=1
Q7A423	7.86e-14	179	286	159	267	Staphylococcal secretory antigen ssaA2 OS=Staphylococcus aureus (strain N315) OX=158879 GN=ssaA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998919	0.000181	0.000214	0.000183	0.000159

TMHMM  Annotations     

start	end
13	35