CAZyme Information: MGYG000000155_01152

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_01152
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000000155_5|CGC1	53656.61	4.8919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 20960; End: 22390 Strand: +

Full Sequence      

MTKNVFPENFLWGGAIAANQTEGAWHEGGRGTSNIDMLPIGEKRMPVKLGQVAHPELDDT
LYYPSHTGIDFYHRYKDDIAVLAEMGLKVFRTSISWSRLYPNGDETTPNAEGIAYYRSLF
ETCREHGMEVLVTLAHFDVPMGLVEGYGSWRSRDMITFFTRYAKTCFEEFGDLVKYWITF
NEINIILHSPFSGAGLAFQEGENQKQVTYQAAHHVLVASALTVKMIHEMLPEAQVGCMIA
GGSFYPYTSKPEDVWQSMLDDHDNTFFIDVQARGYYPSYMKSLLKSKGVDAIEMAEGDEE
ILKNTVDFVSFSYYASRTSAHNLDELVANEGNVVKSAKNPYLPTSKWGWVIDPLGLRITM
NQLYDRYQKPLFLVENGLGAEDVVEADGSINEDYRIDYFRDHIKAMADGIEDGVPLMGFI
AWGVIDLVAASTGQMTKRYGMIYVDKSNDGSGTFNRSKKKSFDWYKQVIASNGVNL

Enzyme Prediction     

No EC number prediction in MGYG000000155_01152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	473	1.1e-145	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	6	476	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	476	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	3	474	1	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	476	1	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.33e-175	1	476	1	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ03290.1	0.0	1	476	1	476
QYU58289.1	0.0	1	476	1	476
QIE79393.1	0.0	1	476	1	476
QBZ05375.1	0.0	1	476	1	476
AVO66845.1	0.0	2	476	3	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	9.68e-200	6	476	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	8.94e-168	5	476	19	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	2.90e-159	3	476	5	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	1.07e-154	6	476	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	1.47e-154	7	476	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	4.83e-239	4	476	2	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	3.97e-201	6	476	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	6.54e-174	6	476	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	4.17e-169	6	476	4	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q48409	9.01e-167	6	476	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000155_01152.