CAZyme Information: MGYG000000155_01868

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_01868
• CAZy Family: GH70
• CAZyme Description: Glucosyltransferase-SI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1412	MGYG000000155_11|CGC1	155718.47	4.3083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 33236; End: 37474 Strand: -

Full Sequence      

MEYDTTKFRKKMYKAGKFWVAAGAMFIGMIMAGPVQADQTTLQPTESVEVTQNETTTDSQ
APDSVTSLSDSTVVGQSSMASVDSNNVAISSSASEVSSQTSSVSSSVASSATMLSAASSA
SASIAATTTDGYHDEGGNWVYYRDGKKLTGRQLIDTFNVYFDKDGHQVKGDWRETDGKQA
YYDGQEGRALTETQVVDGVVRGFDADGYEITNGFGQTSNRDTYYFDNDGNYVTGIQVIDG
QTYNFDDQGRMLKGLAAEVNGTMMYFDDQTGVATPTSDPKFSPELEPVPTENAQHNAAHG
TTPEDFDNMAGYLTADTWYRPNDILDNGVTWRESTPTEYRPLIETWWPTKQTQADYVNYM
NDALQVSTKSVSAADSEATLTAAADAIQAAIERQITVKQSTDWLHELMAAFVATQPQWNK
SSEDENDDHLQGGALSFENNSDTDANSDYRLMNRTPTNQTGDRLYHIDDSLGGYELLLAN
DVDNSNPQVQAEQLNWLYYLMNFGSITANDPDANFDAIRVDAVDNVDADLLQLAAQYFRE
AYGMATNDATSNQHLSILEDWSHNDPAYMNDHGNDQLTMDDYMHTQLIWSLTKSDAQRGK
MDRFLDFYLTNRANDNTENEAQPSYSFVRAHDSEVQTVIAEIVTKLHPEAGNGLMPTQAQ
MDEAFKIYNADQKKAVKEYTHYNMPSAYAMLLTNKDVIPRVYYGDLYTDDGQYMATKSPY
FDAIDALLKARTKYVAGGQTMAVDKNDVMTSVRFGKGAMTVNDAGTAETRTEGVGLIISN
NHDLKMADSDQVVLHMGIAHANQAFRAVIMTTATGLAVYNDDNAPIRYTDANGDLIFTNK
DVYGVLNPQVSGFLAMWVPVGASATQDARTAASTEATTDGSAYHSNAALDSQVIFEGFSN
FQAMPTTHDEYTNVVLAKHADLLTDWGVTSVQLAPQYRSSTDGTFLDSIIQNGYAFTDRY
DLGFGTPTKYGDDNDLRDVIKALHTNGIQVMADFVPDQLYALPGKELVQVTRTNNMGEPD
KNSEIQHLMYVTSTRGGGEYQKQYGGEFLAKLRELYPALFTTNQVSTGKPIDDSVKIKEW
SAKYLNGTAIQGRGAGYVLRDAGNNSYYRVTANTGNANLPNQMLGKPVMTGFHKLADGYH
FETLSGSAATDAFIKDDNGELYYFDENGVMVTGKQTRHGSQYFFLPNGIALTDAFVEAED
GNMQYYDKNGKLVVNQYVTDHQANAFRVDADGNVIRSQALTVDGNDQYFGSNGVQAKAQL
VRDANGQAHYYAAGNGNMIKRQFILDTDGHWLYADQNGNLARGMTTINQDTLYFDDQNHQ
VKDDFVYDADGVHYFNGTNGAEVKSDYAYHNGKWYYFDENGRMVTGLQTINGELRYFGAD
GSQLKGGQATNQETHQTYVFDATNGSGQLVTI

Enzyme Prediction     

EC	2.4.1.5	2.4.1.-	2.4.1.140

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH70	342	1133	0	0.9950186799501868

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02324	Glyco_hydro_70	0.0	342	1132	1	799	Glycosyl hydrolase family 70. Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyze the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain.
TIGR04035	glucan_65_rpt	1.95e-13	1162	1221	1	60	glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
COG5263	COG5263	6.33e-13	1224	1406	89	273	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
TIGR04035	glucan_65_rpt	8.76e-13	1355	1411	1	53	glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
TIGR04035	glucan_65_rpt	9.48e-13	141	198	1	60	glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCF30682.1	0.0	1	1412	1	1412
QIE78080.1	0.0	1	1412	1	1412
QYU57521.1	0.0	1	1412	1	1412
QBZ03616.1	0.0	12	1412	1	1401
AKE50934.1	0.0	12	1412	1	1401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AIB_A	1.06e-304	293	1124	3	842	CrystalStructure of Glucansucrase [Streptococcus mutans],3AIB_B Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_C Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_D Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_E Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_F Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_G Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_H Crystal Structure of Glucansucrase [Streptococcus mutans],3AIC_A Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_B Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_C Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_D Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_E Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_F Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_G Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_H Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_A Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_B Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_C Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_D Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_E Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_F Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_G Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_H Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans]
3KLK_A	1.18e-304	264	1187	30	964	Crystalstructure of Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in triclinic apo- form [Limosilactobacillus reuteri],4AYG_A Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in orthorhombic apo-form [Limosilactobacillus reuteri],4AYG_B Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in orthorhombic apo-form [Limosilactobacillus reuteri]
3HZ3_A	6.62e-304	264	1187	30	964	Lactobacillusreuteri N-terminally truncated glucansucrase GTF180(D1025N)-sucrose complex [Limosilactobacillus reuteri]
6SYQ_B	5.29e-296	132	1187	3	1137	ChainB, Alternansucrase [Leuconostoc mesenteroides]
5LFC_A	2.17e-294	253	1236	227	1273	Crystalstructure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M [Leuconostoc citreum],5LFC_B Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M [Leuconostoc citreum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P08987	0.0	260	1405	187	1340	Glucosyltransferase-I OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfB PE=3 SV=3
P11001	0.0	280	1405	207	1342	Glucosyltransferase-I OS=Streptococcus downei OX=1317 GN=gtfI PE=3 SV=1
P13470	0.0	293	1406	246	1369	Glucosyltransferase-SI OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfC PE=1 SV=2
P27470	0.0	293	1405	214	1337	Glucosyltransferase-I OS=Streptococcus downei OX=1317 PE=3 SV=1
P49331	0.0	253	1395	192	1363	Glucosyltransferase-S OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfD PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000570	0.998557	0.000361	0.000168	0.000159	0.000147

TMHMM  Annotations     

start	end
13	35